Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1523575

    Description: epitope description:VSYAHGFKGLVD antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 7551027;

  2. Coimmunization with complementary glucosyltransferase peptides results in enhanced immunogenicity and protection against dental caries.

    ID: 1542285

    Description: epitope description:TGAQTIKGQKLYFKANGQQVKG antigen name:KxYKxGKxW signal domain protein host organism:Rattus norvegicus

    Publication: 10768962;

  3. Coimmunization with complementary glucosyltransferase peptides results in enhanced immunogenicity and protection against dental caries.

    ID: 1542286

    Description: epitope description:TGAQTIKGQKLYFKANGQQVKG antigen name:KxYKxGKxW signal domain protein host organism:Rattus norvegicus

    Publication: 10768962;

  4. Unfolding/refolding studies on bovine beta-lactoglobulin with monoclonal antibodies as probes. Does a renatured protein completely refold?

    ID: 1542298

    Description: epitope description:KGLDIQKVAGTW antigen name:Bos d 5 host organism:Mus musculus antibody name:31A4

    Publication: 7693669;

  5. Unfolding/refolding studies on bovine beta-lactoglobulin with monoclonal antibodies as probes. Does a renatured protein completely refold?

    ID: 1542300

    Description: epitope description:TPEVDDEALEK antigen name:Bos d 5 host organism:Mus musculus antibody name:61B4

    Publication: 7693669;

  6. Epitope mapping and accessibility of immunodominant regions of yeast plasma membrane H(+)-ATPase.

    ID: 1542302

    Description: epitope description:EKPAKTYDDAASESSDDDDIDALIEELQSNHGVDDEDSDNDGPVAAGEARPVPEEYLQ antigen name:Plasma membrane ATPase 1 host organism:Oryctolagus cunicul...

    Publication: 7681777;

  7. Epitope mapping and accessibility of immunodominant regions of yeast plasma membrane H(+)-ATPase.

    ID: 1542303

    Description: epitope description:IEELQSNHGVDDEDSDNDGPVAAGEARPVPEEYLQTDPSYGLTSDEVLKRRKKYGLNQM antigen name:Plasma membrane ATPase 1 host organism:Oryctolagus cunicu...

    Publication: 7681777;

  8. Epitope mapping and accessibility of immunodominant regions of yeast plasma membrane H(+)-ATPase.

    ID: 1542310

    Description: epitope description:IVDELKKTLANTAVVIRDGQLVEIPANEVVPGDILQLEDGT antigen name:Plasma membrane ATPase 1 host organism:Mus musculus antibody name:4 (AT1-1-...

    Publication: 7681777;

  9. Epitope mapping and accessibility of immunodominant regions of yeast plasma membrane H(+)-ATPase.

    ID: 1542313

    Description: epitope description:VDDEDSD antigen name:Plasma membrane ATPase 1 host organism:Mus musculus antibody name:6 (AT1-1-B4/1-E9), 18 (AT1-4-C3/1-G12)

    Publication: 7681777;

  10. Epitope mapping and accessibility of immunodominant regions of yeast plasma membrane H(+)-ATPase.

    ID: 1542320

    Description: epitope description:VDDEDSD antigen name:Plasma membrane ATPase 1 host organism:Mus musculus antibody name:6 (AT1-1-B4/1-E9), 18 (AT1-4-C3/1-G12)

    Publication: 7681777;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston