Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512059

    Description: epitope description:AKLGAAASSPDA antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  2. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512060

    Description: epitope description:LGAAASSPDAHV antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  3. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512062

    Description: epitope description:ASSPDAHVPFCF antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  4. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512065

    Description: epitope description:HVPFCFGKDLKR antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  5. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512066

    Description: epitope description:PFCFGKDLKRPG antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  6. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512067

    Description: epitope description:CFGKDLKRPGSS antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  7. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512069

    Description: epitope description:DLKRPGSSPMEV antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  8. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512071

    Description: epitope description:PGSSPMEVMLRA antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  9. Naturally occurring mutations within 39 amino acids in the envelope glycoprotein of maedi-visna virus alter the neutralization phenotype.

    ID: 1512096

    Description: epitope description:DLKCSLPHRNESNKWTCAARRKGSRRDSLYIAGRDFWGR antigen name:envelope polyprotein host organism:Ovis aries

    Publication: 10482555;

  10. Naturally occurring mutations within 39 amino acids in the envelope glycoprotein of maedi-visna virus alter the neutralization phenotype.

    ID: 1512106

    Description: epitope description:KGSRR antigen name:envelope polyprotein host organism:Ovis aries

    Publication: 10482555;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston