Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512121

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  2. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512122

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  3. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512125

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  4. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512127

    Description: epitope description:DGEEQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  5. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512131

    Description: epitope description:EQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  6. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512139

    Description: epitope description:FDFYEVTSRTPVRAREA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  7. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512140

    Description: epitope description:FDFYEVTSRTPVRAREA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  8. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512155

    Description: epitope description:MNYTGNQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  9. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512159

    Description: epitope description:MNYTGNQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  10. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512164

    Description: epitope description:DLVEYIMNYTGNQQSRWGLGSPNC antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston