Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Synthetic peptides of the E2 glycoprotein of Venezuelan equine encephalomyelitis virus. II. Antibody to the amino terminus protects animals by limitin...

    ID: 1513914

    Description: epitope description:STEELFNEYKLTRPYMARCIRCAVG antigen name:Structural polyprotein host organism:Mus musculus NHI Swiss

    Publication: 1718085;

  2. Protein P4 of double-stranded RNA bacteriophage phi 6 is accessible on the nucleocapsid surface: epitope mapping and orientation of the protein.

    ID: 1513930

    Description: epitope description:DVLIRWGEVA antigen name:Packaging enzyme P4 host organism:Mus musculus BALB/c antibody name:4S11

    Publication: 7682630;

  3. Kinetic analysis of the effect on Fab binding of identical substitutions in a peptide and its parent protein.

    ID: 1513940

    Description: epitope description:RGTGSYNRSSFES antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:57P

    Publication: 10090739;

  4. Synthetic peptides of the E2 glycoprotein of Venezuelan equine encephalomyelitis virus. II. Antibody to the amino terminus protects animals by limitin...

    ID: 1513942

    Description: epitope description:STEELFNEYKLTRPYMARCIRCAVG antigen name:Structural polyprotein host organism:Mus musculus NHI Swiss

    Publication: 1718085;

  5. Protein P4 of double-stranded RNA bacteriophage phi 6 is accessible on the nucleocapsid surface: epitope mapping and orientation of the protein.

    ID: 1513943

    Description: epitope description:KSADVESDV antigen name:Packaging enzyme P4 host organism:Mus musculus BALB/c antibody name:4S3

    Publication: 7682630;

  6. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513951

    Description: epitope description:GVETSRSVFHQN antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  7. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1514060

    Description: epitope description:FGDGFYAQGYLETRFVTKASENGSDNFGD antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus

    Publication: 8500904;

  8. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1514061

    Description: epitope description:FGDITSKYAYVTLGNKAFGEVKLGRAKT antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus

    Publication: 8500904;

  9. Immunogenicity of a synthetic oligopeptide corresponding to antigenically common T-helper and B-cell neutralizing epitopes of the major outer membrane...

    ID: 1514160

    Description: epitope description:LNPTIAG antigen name:Major outer membrane porin, serovar D host organism:Macaca fascicularis

    Publication: 7504381;

  10. Mapping and characterization of antigenic epitopes and the nucleic acid-binding domains of the VP6 protein of bluetongue viruses.

    ID: 1514185

    Description: epitope description:KENKTEPKEESK antigen name:Protein VP6-A host organism:Oryctolagus cuniculus antibody name:oAb #72

    Publication: 7514678;

  11. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1523535

    Description: epitope description:TIKAGVETSRSV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 7551027;

  12. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1523541

    Description: epitope description:FKGQEDLGNGL antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 7551027;

  13. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1523545

    Description: epitope description:GTDSGWGNRQSF antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 7551027;

  14. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1523546

    Description: epitope description:GNRQSFIGLKGG antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 7551027;

  15. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1523548

    Description: epitope description:FGKLRVGRLNSV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 7551027;

  16. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1523550

    Description: epitope description:LKDTGDINPWDS antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 7551027;

  17. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1523554

    Description: epitope description:PEARLISVRYDS antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 7551027;

  18. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1523555

    Description: epitope description:SVRYDSPEFAGL antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 7551027;

  19. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1523560

    Description: epitope description:SYHAGFNYKNGG antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 7551027;

  20. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1523568

    Description: epitope description:ALYASVAVQQQD antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 7551027;

  21. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1523575

    Description: epitope description:VSYAHGFKGLVD antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 7551027;

  22. Coimmunization with complementary glucosyltransferase peptides results in enhanced immunogenicity and protection against dental caries.

    ID: 1542285

    Description: epitope description:TGAQTIKGQKLYFKANGQQVKG antigen name:KxYKxGKxW signal domain protein host organism:Rattus norvegicus

    Publication: 10768962;

  23. Coimmunization with complementary glucosyltransferase peptides results in enhanced immunogenicity and protection against dental caries.

    ID: 1542286

    Description: epitope description:TGAQTIKGQKLYFKANGQQVKG antigen name:KxYKxGKxW signal domain protein host organism:Rattus norvegicus

    Publication: 10768962;

  24. Unfolding/refolding studies on bovine beta-lactoglobulin with monoclonal antibodies as probes. Does a renatured protein completely refold?

    ID: 1542298

    Description: epitope description:KGLDIQKVAGTW antigen name:Bos d 5 host organism:Mus musculus antibody name:31A4

    Publication: 7693669;

  25. Unfolding/refolding studies on bovine beta-lactoglobulin with monoclonal antibodies as probes. Does a renatured protein completely refold?

    ID: 1542300

    Description: epitope description:TPEVDDEALEK antigen name:Bos d 5 host organism:Mus musculus antibody name:61B4

    Publication: 7693669;

  26. Epitope mapping and accessibility of immunodominant regions of yeast plasma membrane H(+)-ATPase.

    ID: 1542302

    Description: epitope description:EKPAKTYDDAASESSDDDDIDALIEELQSNHGVDDEDSDNDGPVAAGEARPVPEEYLQ antigen name:Plasma membrane ATPase 1 host organism:Oryctolagus cunicul...

    Publication: 7681777;

  27. Epitope mapping and accessibility of immunodominant regions of yeast plasma membrane H(+)-ATPase.

    ID: 1542303

    Description: epitope description:IEELQSNHGVDDEDSDNDGPVAAGEARPVPEEYLQTDPSYGLTSDEVLKRRKKYGLNQM antigen name:Plasma membrane ATPase 1 host organism:Oryctolagus cunicu...

    Publication: 7681777;

  28. Epitope mapping and accessibility of immunodominant regions of yeast plasma membrane H(+)-ATPase.

    ID: 1542310

    Description: epitope description:IVDELKKTLANTAVVIRDGQLVEIPANEVVPGDILQLEDGT antigen name:Plasma membrane ATPase 1 host organism:Mus musculus antibody name:4 (AT1-1-...

    Publication: 7681777;

  29. Epitope mapping and accessibility of immunodominant regions of yeast plasma membrane H(+)-ATPase.

    ID: 1542313

    Description: epitope description:VDDEDSD antigen name:Plasma membrane ATPase 1 host organism:Mus musculus antibody name:6 (AT1-1-B4/1-E9), 18 (AT1-4-C3/1-G12)

    Publication: 7681777;

  30. Epitope mapping and accessibility of immunodominant regions of yeast plasma membrane H(+)-ATPase.

    ID: 1542320

    Description: epitope description:VDDEDSD antigen name:Plasma membrane ATPase 1 host organism:Mus musculus antibody name:6 (AT1-1-B4/1-E9), 18 (AT1-4-C3/1-G12)

    Publication: 7681777;

  31. Epitope mapping and accessibility of immunodominant regions of yeast plasma membrane H(+)-ATPase.

    ID: 1542325

    Description: epitope description:IVDELKKTLANTAVVIRDGQLVEIPANEVVPGDILQLEDGT antigen name:Plasma membrane ATPase 1 host organism:Mus musculus antibody name:4 (AT1-1-...

    Publication: 7681777;

  32. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511989

    Description: epitope description:MSDGAVQPDGGQPAV antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  33. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511990

    Description: epitope description:PYVLVKTNMVVT antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  34. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511992

    Description: epitope description:VKTNMVVTSVAM antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  35. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511996

    Description: epitope description:SVAMKPYEVTPT antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  36. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511998

    Description: epitope description:KPYEVTPTRMLV antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  37. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511999

    Description: epitope description:YEVTPTRMLVCG antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1 X BALB/c

    Publication: 7684728;

  38. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512004

    Description: epitope description:CGIAAKLGAAAS antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  39. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512005

    Description: epitope description:IAAKLGAAASSP antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  40. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512007

    Description: epitope description:LGAAASSPDAHV antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  41. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512009

    Description: epitope description:ASSPDAHVPFCF antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1 X BALB/c

    Publication: 7684728;

  42. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512010

    Description: epitope description:SPDAHVPFCFGK antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  43. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512017

    Description: epitope description:DLKRPGSSPMEV antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1 X BALB/c

    Publication: 7684728;

  44. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512021

    Description: epitope description:EVMLRAVFMQQR antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  45. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512022

    Description: epitope description:MLRAVFMQQRPL antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  46. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512029

    Description: epitope description:FLGPKQLTFEGK antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  47. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512051

    Description: epitope description:KPYEVTPTRMLV antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  48. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512052

    Description: epitope description:YEVTPTRMLVCG antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  49. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512056

    Description: epitope description:LVCGIAAKLGAA antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  50. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512057

    Description: epitope description:CGIAAKLGAAAS antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  51. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512059

    Description: epitope description:AKLGAAASSPDA antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  52. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512060

    Description: epitope description:LGAAASSPDAHV antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  53. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512062

    Description: epitope description:ASSPDAHVPFCF antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  54. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512065

    Description: epitope description:HVPFCFGKDLKR antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  55. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512066

    Description: epitope description:PFCFGKDLKRPG antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  56. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512067

    Description: epitope description:CFGKDLKRPGSS antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  57. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512069

    Description: epitope description:DLKRPGSSPMEV antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  58. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512071

    Description: epitope description:PGSSPMEVMLRA antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  59. Naturally occurring mutations within 39 amino acids in the envelope glycoprotein of maedi-visna virus alter the neutralization phenotype.

    ID: 1512096

    Description: epitope description:DLKCSLPHRNESNKWTCAARRKGSRRDSLYIAGRDFWGR antigen name:envelope polyprotein host organism:Ovis aries

    Publication: 10482555;

  60. Naturally occurring mutations within 39 amino acids in the envelope glycoprotein of maedi-visna virus alter the neutralization phenotype.

    ID: 1512106

    Description: epitope description:KGSRR antigen name:envelope polyprotein host organism:Ovis aries

    Publication: 10482555;

  61. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512121

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  62. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512122

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  63. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512125

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  64. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512127

    Description: epitope description:DGEEQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  65. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512131

    Description: epitope description:EQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  66. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512139

    Description: epitope description:FDFYEVTSRTPVRAREA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  67. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512140

    Description: epitope description:FDFYEVTSRTPVRAREA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  68. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512155

    Description: epitope description:MNYTGNQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  69. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512159

    Description: epitope description:MNYTGNQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  70. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512164

    Description: epitope description:DLVEYIMNYTGNQQSRWGLGSPNC antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  71. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512165

    Description: epitope description:MNYTGNQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  72. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512169

    Description: epitope description:MNYTGNQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  73. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512170

    Description: epitope description:DLVEYIMNYTGNQQSRWGLGSPNC antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  74. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512174

    Description: epitope description:HGPDWASPVCQRHSPDCSRLVG antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  75. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512201

    Description: epitope description:ASSPDAHVPFCFGKDLKRPGSSPME antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  76. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512217

    Description: epitope description:QLTFEGKPALELIRMVECSGKQDCP antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  77. Pathotyping isolates of Newcastle disease virus using antipeptide antibodies to pathotype-specific regions of their fusion and hemagglutinin-neuramini...

    ID: 1512219

    Description: epitope description:VTTSGGGRQG antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 10076509;

  78. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512234

    Description: epitope description:FLGPKQLTFEGKPALELIRMVECSG antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  79. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512238

    Description: epitope description:MVVTSVAMKPYEVTPTRMLVCGIAA antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  80. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512251

    Description: epitope description:AASSPDA antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  81. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512255

    Description: epitope description:VECSGKQDCP antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  82. Pathotyping isolates of Newcastle disease virus using antipeptide antibodies to pathotype-specific regions of their fusion and hemagglutinin-neuramini...

    ID: 1512298

    Description: epitope description:VTTSGGRRQ antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 10076509;

  83. Pathotyping isolates of Newcastle disease virus using antipeptide antibodies to pathotype-specific regions of their fusion and hemagglutinin-neuramini...

    ID: 1512302

    Description: epitope description:REARSGRLSQLRE antigen name:Hemagglutinin-neuraminidase host organism:Oryctolagus cuniculus

    Publication: 10076509;

  84. Mutational analysis of the virus and monoclonal antibody binding sites in MHVR, the cellular receptor of the murine coronavirus mouse hepatitis virus ...

    ID: 1512305

    Description: epitope description:L60, A61, L62, G63, A64, F65, A66, D76, K77 antigen name:Carcinoembryonic antigen-related cell adhesion molecule 1 host organism:M...

    Publication: 9499047;

  85. Defining antibody targets in Streptococcus oralis infection.

    ID: 1512324

    Description: epitope description:TMYPNRQPGSGWDSS antigen name:Cell wall surface anchor family protein host organism:Homo sapiens

    Publication: 8613367;

  86. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512326

    Description: epitope description:RGDL antigen name:Polyprotein host organism:Mus musculus antibody name:7FC12, 7AH1, 7JD1, 7CA11

    Publication: 7690714;

  87. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512344

    Description: epitope description:RGDL antigen name:Polyprotein host organism:Mus musculus antibody name:7JD1, 7CA11

    Publication: 7690714;

  88. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512346

    Description: epitope description:RGDL antigen name:Polyprotein host organism:Mus musculus antibody name:7JD1, 7CA11

    Publication: 7690714;

  89. Defining antibody targets in Streptococcus oralis infection.

    ID: 1512355

    Description: epitope description:YPTVV antigen name:Cell wall surface anchor family protein host organism:Homo sapiens

    Publication: 8613367;

  90. Defining antibody targets in Streptococcus oralis infection.

    ID: 1512365

    Description: epitope description:YPTVV antigen name:Cell wall surface anchor family protein host organism:Homo sapiens

    Publication: 8613367;

  91. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512389

    Description: epitope description:RGDLXRGDLXRGDL host organism:Cavia porcellus Duncan-Hartley

    Publication: 7690714;

  92. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512390

    Description: epitope description:ARGDLAXARGDLAXARGDLA host organism:Cavia porcellus Duncan-Hartley

    Publication: 7690714;

  93. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512392

    Description: epitope description:RGDLRGDLRGDL host organism:Cavia porcellus Duncan-Hartley

    Publication: 7690714;

  94. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512393

    Description: epitope description:RGDLRGDLRGDL host organism:Cavia porcellus Duncan-Hartley

    Publication: 7690714;

  95. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512404

    Description: epitope description:RGDLRGDLRGDL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7690714;

  96. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512407

    Description: epitope description:RGDLARGDLARGDL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7690714;

  97. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512420

    Description: epitope description:RGDLRGDLRGDL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7690714;

  98. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512424

    Description: epitope description:VARGDLAARGDLAARGDLA host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7690714;

  99. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512425

    Description: epitope description:RGDLXRGDLXRGDL host organism:Cavia porcellus Duncan-Hartley

    Publication: 7690714;

  100. Structure-function analyses of diphtheria toxin by use of monoclonal antibodies.

    ID: 1512451

    Description: epitope description:GVHANLHVAFHRSSSEKIHSNEISSDSIGVLGYQKTVDHTKVNSKLSLFFEIKS antigen name:Diphtheria toxin (UniProt:H2GU79) host organism:Mus musculus B...

    Publication: 7679377;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston