Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Determination of the human antibody response to the epitope defined by the hepatitis C virus-neutralizing monoclonal antibody AP33.

    ID: 1477876

    Description: epitope description:QLVNSNGSWHIN antigen name:Genome polyprotein host organism:Rattus norvegicus antibody name:3/11

    Publication: 17947521;

  2. Validation of synthetic peptide enzyme immunoassays in differentiating two subgroups of ruminant respiratory syncytial virus.

    ID: 1477890

    Description: epitope description:VPCSTCEGNLACLSLCQ antigen name:Major surface glycoprotein G host organism:Ovis aries

    Publication: 11289207;

  3. Localization of antigenic sites of the S glycoprotein of feline infectious peritonitis virus involved in neutralization and antibody-dependent enhance...

    ID: 1477897

    Description: epitope description:D568, R656 antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:18A7.4

    Publication: 7707508;

  4. Localization of antigenic sites of the S glycoprotein of feline infectious peritonitis virus involved in neutralization and antibody-dependent enhance...

    ID: 1477899

    Description: epitope description:D643 antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:24H5.4

    Publication: 7707508;

  5. Type- and subcomplex-specific neutralizing antibodies against domain III of dengue virus type 2 envelope protein recognize adjacent epitopes.

    ID: 1477902

    Description: epitope description:G304, K305, K307, K310 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1A1D-2

    Publication: 17881453;

  6. Type- and subcomplex-specific neutralizing antibodies against domain III of dengue virus type 2 envelope protein recognize adjacent epitopes.

    ID: 1477904

    Description: epitope description:G304, K305, K307, K310 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1A1D-2

    Publication: 17881453;

  7. Type- and subcomplex-specific neutralizing antibodies against domain III of dengue virus type 2 envelope protein recognize adjacent epitopes.

    ID: 1477907

    Description: epitope description:H317 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5A2-7, WN E111

    Publication: 17881453;

  8. Type- and subcomplex-specific neutralizing antibodies against domain III of dengue virus type 2 envelope protein recognize adjacent epitopes.

    ID: 1477909

    Description: epitope description:H317 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5A2-7, WN E111

    Publication: 17881453;

  9. Type- and subcomplex-specific neutralizing antibodies against domain III of dengue virus type 2 envelope protein recognize adjacent epitopes.

    ID: 1477915

    Description: epitope description:H317,T359 antigen name:Genome polyprotein host organism:Mus musculus antibody name:13D4-1

    Publication: 17881453;

  10. Type- and subcomplex-specific neutralizing antibodies against domain III of dengue virus type 2 envelope protein recognize adjacent epitopes.

    ID: 1477922

    Description: epitope description:G304, K310 antigen name:Genome polyprotein host organism:Mus musculus antibody name:WN E114

    Publication: 17881453;

  11. Identification of two neutralization epitopes on the capsid protein of avian hepatitis E virus.

    ID: 1477963

    Description: epitope description:TVDASSGSNRFAALPAFGKPAVWGPQGAGYFYQYNSTH antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:5G10

    Publication: 18198381;

  12. Identification of two neutralization epitopes on the capsid protein of avian hepatitis E virus.

    ID: 1477967

    Description: epitope description:HQEWIYFLQNGSSVVWYAYTNMLGQKSDTSILFEVRPIQASDQPWFLAHHTGGDDCTT antigen name:Capsid protein host organism:Mus musculus BALB/c antibody ...

    Publication: 18198381;

  13. Identification of two neutralization epitopes on the capsid protein of avian hepatitis E virus.

    ID: 1477968

    Description: epitope description:HQEWIYFLQNGSSVVWYAYTNMLGQKSDTSILFEVRPIQASDQPWFLAHHTGGDDCTT antigen name:Capsid protein host organism:Mus musculus BALB/c antibody ...

    Publication: 18198381;

  14. Identification of aleutian mink disease parvovirus capsid sequences mediating antibody-dependent enhancement of infection, virus neutralization, and i...

    ID: 1477983

    Description: epitope description:EQELNFPHEVLDDAA antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 11602751;

  15. Vaccines prepared from chimeras of foot-and-mouth disease virus (FMDV) induce neutralizing antibodies and protective immunity to multiple serotypes of...

    ID: 1477991

    Description: epitope description:T678, T681 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2PD11

    Publication: 7523697;

  16. A peptide construct containing B-cell and T-cell epitopes from the foot-and-mouth disease viral VP1 protein induces efficient antiviral protection.

    ID: 1482066

    Description: epitope description:KYSAGGMGRRGDLEPLAARVAAQL antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 10075164;

  17. Localization of T and B cell stimulating domains of the immunodominant 33-kDa protein of Onchocerca volvulus (Ov33).

    ID: 1482091

    Description: epitope description:QKYLSSTIQKQVD antigen name:Immunodominant antigen Ov33-3 host organism:Homo sapiens antibody name:Human sera

    Publication: 9325070;

  18. A peptide construct containing B-cell and T-cell epitopes from the foot-and-mouth disease viral VP1 protein induces efficient antiviral protection.

    ID: 1482110

    Description: epitope description:TTIHELLVRMKRAELYCPR antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 10075164;

  19. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482116

    Description: epitope description:LEQPVSNDLS antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  20. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482119

    Description: epitope description:DLYKSNHNNV antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  21. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482130

    Description: epitope description:DSESGGHITH antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  22. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482132

    Description: epitope description:KDNPHPKGSR antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  23. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482136

    Description: epitope description:EKPNLSSKRSE antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  24. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482137

    Description: epitope description:LEQPVSNDLS antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  25. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482138

    Description: epitope description:PYQGSGKGVS antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  26. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482141

    Description: epitope description:DSESGGHITH antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  27. Induction of anti foot and mouth disease virus T and B cell responses in cattle immunized with a peptide representing ten amino acids of VP1.

    ID: 1482145

    Description: epitope description:RYSRNAVPNV antigen name:Polyprotein host organism:Bos taurus Holstein-Friesian

    Publication: 9569465;

  28. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482153

    Description: epitope description:LEQPVSNDLS antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  29. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482157

    Description: epitope description:DSESGGHITH antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  30. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482158

    Description: epitope description:SCTVTREDGT antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  31. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482166

    Description: epitope description:DLYKSNHNNV antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  32. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482168

    Description: epitope description:SCTVTREDGT antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  33. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482170

    Description: epitope description:NPDREYDFRD antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  34. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482184

    Description: epitope description:SCTVTREDGT antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  35. Antigenic analysis of bean pod mottle virus using linear and cyclized synthetic peptides.

    ID: 1482195

    Description: epitope description:AFSVPQANARSSENAESSA antigen name:RNA2 polyprotein host organism:Oryctolagus cuniculus antibody name:anti-BPMV

    Publication: 7679572;

  36. Enhanced immunogenicity of a conformational epitope of human T-lymphotropic virus type 1 using a novel chimeric peptide.

    ID: 1482202

    Description: epitope description:FLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zeala...

    Publication: 11137241;

  37. Enhanced immunogenicity of a conformational epitope of human T-lymphotropic virus type 1 using a novel chimeric peptide.

    ID: 1482203

    Description: epitope description:FLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTL antigen name:Envelope glycoprotein gp62 host organism:Mus musculus ICR

    Publication: 11137241;

  38. Type-independent detection of foot-and-mouth disease virus by monoclonal antibodies that bind to amino-terminal residues of capsid protein VP2.

    ID: 1482213

    Description: epitope description:ETTLLEDRILTTRNG antigen name:Genome polyprotein host organism:Mus musculus antibody name:13A6

    Publication: 11226567;

  39. Type-independent detection of foot-and-mouth disease virus by monoclonal antibodies that bind to amino-terminal residues of capsid protein VP2.

    ID: 1482215

    Description: epitope description:DKKTEETTLLEDRIL antigen name:Genome polyprotein host organism:Mus musculus antibody name:13A6

    Publication: 11226567;

  40. Type-independent detection of foot-and-mouth disease virus by monoclonal antibodies that bind to amino-terminal residues of capsid protein VP2.

    ID: 1482221

    Description: epitope description:DKKTEETTLLEDRIL antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:15F7

    Publication: 11226567;

  41. Type-independent detection of foot-and-mouth disease virus by monoclonal antibodies that bind to amino-terminal residues of capsid protein VP2.

    ID: 1482222

    Description: epitope description:ETTLLEDRILTTRNG antigen name:Genome polyprotein host organism:Mus musculus antibody name:13A6

    Publication: 11226567;

  42. Location of a highly conserved neutralizing epitope in the F glycoprotein of human respiratory syncytial virus.

    ID: 1482232

    Description: epitope description:N262, N268 antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c antibody name:47F

    Publication: 1688629;

  43. Antigenic analysis of bean pod mottle virus using linear and cyclized synthetic peptides.

    ID: 1482234

    Description: epitope description:FDSSKQSF antigen name:RNA2 polyprotein host organism:Oryctolagus cuniculus antibody name:anti-A20-27

    Publication: 7679572;

  44. Antigenic analysis of bean pod mottle virus using linear and cyclized synthetic peptides.

    ID: 1482240

    Description: epitope description:SIRGRASSDIY antigen name:RNA2 polyprotein host organism:Oryctolagus cuniculus antibody name:anti-C95-105

    Publication: 7679572;

  45. Protection of guinea-pigs against foot-and-mouth disease virus by immunization with a PhoE-FMDV hybrid protein.

    ID: 1482242

    Description: epitope description:YKQKIIAPYKQKIIAPSRRGDLGSLAPRV host organism:Cavia porcellus Duncan-Hartley

    Publication: 2174595;

  46. Molecular basis for linkage of a continuous and discontinuous neutralization epitope on the structural polypeptide VP2 of poliovirus type 1.

    ID: 1482258

    Description: epitope description:H142, N165, N166, T168 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:27.108

    Publication: 1689392;

  47. Neutralizing epitopes of type O foot-and-mouth disease virus. II. Mapping three conformational sites with synthetic peptide reagents.

    ID: 1482269

    Description: epitope description:N143, L144, R145, G146, R200, H201, K202, Q203, K204, I205, V206, A207, P208, V209, K210, Q211, T212, L213 antigen name:Genome po...

    Publication: 2471812;

  48. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482275

    Description: epitope description:IGRVADTVGTGPNNS antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7513917;

  49. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482293

    Description: epitope description:SIPFLSIGNAYSNFY antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7513917;

  50. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482296

    Description: epitope description:TLNNMGTLYARHVNA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7513917;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston