Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512389

    Description: epitope description:RGDLXRGDLXRGDL host organism:Cavia porcellus Duncan-Hartley

    Publication: 7690714;

  2. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512390

    Description: epitope description:ARGDLAXARGDLAXARGDLA host organism:Cavia porcellus Duncan-Hartley

    Publication: 7690714;

  3. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512392

    Description: epitope description:RGDLRGDLRGDL host organism:Cavia porcellus Duncan-Hartley

    Publication: 7690714;

  4. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512393

    Description: epitope description:RGDLRGDLRGDL host organism:Cavia porcellus Duncan-Hartley

    Publication: 7690714;

  5. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512404

    Description: epitope description:RGDLRGDLRGDL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7690714;

  6. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512407

    Description: epitope description:RGDLARGDLARGDL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7690714;

  7. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512420

    Description: epitope description:RGDLRGDLRGDL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7690714;

  8. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512424

    Description: epitope description:VARGDLAARGDLAARGDLA host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7690714;

  9. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512425

    Description: epitope description:RGDLXRGDLXRGDL host organism:Cavia porcellus Duncan-Hartley

    Publication: 7690714;

  10. Structure-function analyses of diphtheria toxin by use of monoclonal antibodies.

    ID: 1512451

    Description: epitope description:GVHANLHVAFHRSSSEKIHSNEISSDSIGVLGYQKTVDHTKVNSKLSLFFEIKS antigen name:Diphtheria toxin (UniProt:H2GU79) host organism:Mus musculus B...

    Publication: 7679377;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston