Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969952

    Description: epitope description:IDNNGFLDKNDFECL antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  2. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969955

    Description: epitope description:NDFECLAVRNTLIEG antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  3. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969982

    Description: epitope description:QFKAIDVNGDGKVGL antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  4. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1970000

    Description: epitope description:ERYQDLYAQFISNPD antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  5. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1970003

    Description: epitope description:FISNPDESCSACYLF antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  6. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1970005

    Description: epitope description:ESCSACYLFGPLKVV antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  7. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1970019

    Description: epitope description:KDKRTSLGATLLDVI antigen name:Lit v 2 host organism:Homo sapiens

    Publication: 20471069;

  8. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1970033

    Description: epitope description:FDPIIEDYHVGFKQT antigen name:Lit v 2 host organism:Homo sapiens

    Publication: 20471069;

  9. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1970042

    Description: epitope description:SFVNVDPEGKFVIST antigen name:Lit v 2 host organism:Homo sapiens

    Publication: 20471069;

  10. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1970055

    Description: epitope description:MEAKVSSTLSSLEGE antigen name:Lit v 2 host organism:Homo sapiens

    Publication: 20471069;

  11. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1970062

    Description: epitope description:PLTGMSKEVQQKLID antigen name:Lit v 2 host organism:Homo sapiens

    Publication: 20471069;

  12. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1970078

    Description: epitope description:TFLVWVNEEDHLRII antigen name:Lit v 2 host organism:Homo sapiens

    Publication: 20471069;

  13. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1970096

    Description: epitope description:CPTNLGTTVRASVHI antigen name:Lit v 2 host organism:Homo sapiens

    Publication: 20471069;

  14. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1970098

    Description: epitope description:TTVRASVHIKLPKLA antigen name:Lit v 2 host organism:Homo sapiens

    Publication: 20471069;

  15. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1970099

    Description: epitope description:RASVHIKLPKLAANR antigen name:Lit v 2 host organism:Homo sapiens

    Publication: 20471069;

  16. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1970100

    Description: epitope description:VHIKLPKLAANREKL antigen name:Lit v 2 host organism:Homo sapiens

    Publication: 20471069;

  17. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1970103

    Description: epitope description:ANREKLEEVAGKYNL antigen name:Lit v 2 host organism:Homo sapiens

    Publication: 20471069;

  18. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1970105

    Description: epitope description:EEVAGKYNLQVRGTR antigen name:Lit v 2 host organism:Homo sapiens

    Publication: 20471069;

  19. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1970115

    Description: epitope description:KRRMGLTEFQAVKEM antigen name:Lit v 2 host organism:Homo sapiens

    Publication: 20471069;

  20. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1970117

    Description: epitope description:TEFQAVKEMQDGILE antigen name:Lit v 2 host organism:Homo sapiens

    Publication: 20471069;

  21. Identification of three novel linear B-cell epitopes on the VP5 protein of BTV16.

    ID: 1970201

    Description: epitope description:STMVKEYRQKIDALKA antigen name:Outer capsid protein VP5 host organism:Mus musculus BALB/c antibody name:4A6

    Publication: 23290575;

  22. Fine level epitope mapping and conservation analysis of two novel linear B-cell epitopes of the avian infectious bronchitis coronavirus nucleocapsid p...

    ID: 1970207

    Description: epitope description:FGPRTK antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:6D10

    Publication: 23123213;

  23. Fine level epitope mapping and conservation analysis of two novel linear B-cell epitopes of the avian infectious bronchitis coronavirus nucleocapsid p...

    ID: 1970208

    Description: epitope description:FGPRTK antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:6D10

    Publication: 23123213;

  24. Targeted delivery of interferon-alpha to hepatitis B virus-infected cells using T-cell receptor-like antibodies.

    ID: 1970221

    Description: epitope description:FLLTRILTI antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:sTCR-L

    Publication: 22684948;

  25. Fine level epitope mapping and conservation analysis of two novel linear B-cell epitopes of the avian infectious bronchitis coronavirus nucleocapsid p...

    ID: 1970223

    Description: epitope description:FGPRTK antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:6D10

    Publication: 23123213;

  26. Fine level epitope mapping and conservation analysis of two novel linear B-cell epitopes of the avian infectious bronchitis coronavirus nucleocapsid p...

    ID: 1970224

    Description: epitope description:FGPRTK antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:6D10

    Publication: 23123213;

  27. Targeted delivery of interferon-alpha to hepatitis B virus-infected cells using T-cell receptor-like antibodies.

    ID: 1970251

    Description: epitope description:FLPSDFFPSV antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:cTCR-L

    Publication: 22684948;

  28. Low levels of IgM antibodies to oxidized cardiolipin increase and high levels decrease risk of cardiovascular disease among 60-year olds: a prospectiv...

    ID: 1970260

    Description: epitope description:oxidised cardiolipin host organism:Homo sapiens

    Publication: 23294904;

  29. A plaque-specific antibody clears existing beta-amyloid plaques in Alzheimer's disease mice.

    ID: 1970266

    Description: epitope description:EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA + PYRE(E1) antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:...

    Publication: 23217740;

  30. Identification and structural characterization of a broadly neutralizing antibody targeting a novel conserved epitope on the influenza virus H5N1 hema...

    ID: 1970301

    Description: epitope description:NVPEWSYIVEKANPANDLCYPGNFNDYEELKHLLSRINHFEKIQ antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:HA-7

    Publication: 23221567;

  31. Is epitope recognition of shrimp allergens useful to predict clinical reactivity?

    ID: 1970307

    Description: epitope description:NPDESCSACYLFGPL antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 22192087;

  32. Maturation of shark single-domain (IgNAR) antibodies: evidence for induced-fit binding.

    ID: 1970315

    Description: epitope description:E53, N64, T65, D66, S68, D70, Q75, I76, N77, R79, W80, W81, R91, L93, I116, D119, G120, N121, A125, W126, V127, R130 antigen name:...

    Publication: 17258766;

  33. Mapping B-cell linear epitopes of NS3 protein of bovine viral diarrhea virus.

    ID: 1970331

    Description: epitope description:CHVNILDKLTAFFGVMP antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 23276751;

  34. Mapping B-cell linear epitopes of NS3 protein of bovine viral diarrhea virus.

    ID: 1970340

    Description: epitope description:PVRFPTALLKVRRGLET antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 23276751;

  35. Identification of immunodominant peptides from Gnathostoma binucleatum.

    ID: 1970355

    Description: epitope description:NALQAGNWGNEER antigen name:Gnathostoma binucleatum protein host organism:Homo sapiens

    Publication: 22949520;

  36. Identification of immunodominant peptides from Gnathostoma binucleatum.

    ID: 1970356

    Description: epitope description:YYPVPYESGISQGLSVGR antigen name:Gnathostoma binucleatum protein host organism:Homo sapiens

    Publication: 22949520;

  37. Identification of immunodominant peptides from Gnathostoma binucleatum.

    ID: 1970359

    Description: epitope description:RNGDIALHFNPR antigen name:Gnathostoma binucleatum protein host organism:Homo sapiens

    Publication: 22949520;

  38. Characterisation and haemagglutinin gene epitope mapping of a variant strain of H5N1 subtype avian influenza virus.

    ID: 1970407

    Description: epitope description:L145, E155, N156 antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 23265247;

  39. Characterisation and haemagglutinin gene epitope mapping of a variant strain of H5N1 subtype avian influenza virus.

    ID: 1970408

    Description: epitope description:G154, K155 antigen name:Hemagglutinin host organism:Gallus gallus White Leghorn

    Publication: 23265247;

  40. A sequence in subdomain 2 of DBL1alpha of Plasmodium falciparum erythrocyte membrane protein 1 induces strain transcending antibodies.

    ID: 1970414

    Description: epitope description:HLRHEPGIQHLEKRLESMFQNIQN antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Oryctolagus cuniculus

    Publication: 23335956;

  41. A sequence in subdomain 2 of DBL1alpha of Plasmodium falciparum erythrocyte membrane protein 1 induces strain transcending antibodies.

    ID: 1970423

    Description: epitope description:TDNDEVWKGLRAVFGKI antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Rattus

    Publication: 23335956;

  42. Probing structural variability at the N terminus of the TSH receptor with a murine monoclonal antibody that distinguishes between two receptor conform...

    ID: 1970426

    Description: epitope description:ECHQEEDFRVTC antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c antibody name:3BD10, 3E5

    Publication: 23183178;

  43. A sequence in subdomain 2 of DBL1alpha of Plasmodium falciparum erythrocyte membrane protein 1 induces strain transcending antibodies.

    ID: 1970431

    Description: epitope description:HLRHEPGIQHLEKRLESMFQNIQN antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Rattus

    Publication: 23335956;

  44. A sequence in subdomain 2 of DBL1alpha of Plasmodium falciparum erythrocyte membrane protein 1 induces strain transcending antibodies.

    ID: 1970434

    Description: epitope description:ITCGATMNDIFSKNIR antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Oryctolagus cuniculus

    Publication: 23335956;

  45. A sequence in subdomain 2 of DBL1alpha of Plasmodium falciparum erythrocyte membrane protein 1 induces strain transcending antibodies.

    ID: 1970439

    Description: epitope description:SNICTVLARSFADIGDIV antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Rattus

    Publication: 23335956;

  46. A sequence in subdomain 2 of DBL1alpha of Plasmodium falciparum erythrocyte membrane protein 1 induces strain transcending antibodies.

    ID: 1970440

    Description: epitope description:KLQTLTLHQVREYWWALNRKEVWKA antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Rattus

    Publication: 23335956;

  47. Probing structural variability at the N terminus of the TSH receptor with a murine monoclonal antibody that distinguishes between two receptor conform...

    ID: 1970447

    Description: epitope description:ECHQEEDFRVTC antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c antibody name:3BD10, 3E5

    Publication: 23183178;

  48. A sequence in subdomain 2 of DBL1alpha of Plasmodium falciparum erythrocyte membrane protein 1 induces strain transcending antibodies.

    ID: 1970457

    Description: epitope description:KLQTLTLHQVREYWWALNRKEVWKA antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Oryctolagus cuniculus

    Publication: 23335956;

  49. A sequence in subdomain 2 of DBL1alpha of Plasmodium falciparum erythrocyte membrane protein 1 induces strain transcending antibodies.

    ID: 1970458

    Description: epitope description:KLQTLTLHQVREYWWALNRKEVWKA antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Oryctolagus cuniculus

    Publication: 23335956;

  50. A sequence in subdomain 2 of DBL1alpha of Plasmodium falciparum erythrocyte membrane protein 1 induces strain transcending antibodies.

    ID: 1970462

    Description: epitope description:KLQTLTLHQVREYWWALNRKEVWKA antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Oryctolagus cuniculus

    Publication: 23335956;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston