Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Discontinuous epitopes of hepatitis B surface antigen derived from a filamentous phage peptide library.

    ID: 1350698

    Description: epitope description:RASGARARCEHRSGLSLSWQPSECSDSRTT host organism:Mus musculus antibody name:H35

    Publication: 8700874;

  2. Enhanced immunogenicity of the pre-S region of hepatitis B surface antigen.

    ID: 1350708

    Description: epitope description:MQWNSTALHQALQDPRVRGLYLPAGG antigen name:Large envelope protein host organism:Mus musculus

    Publication: 2408336;

  3. Protease-activated lymphoid cell and hepatocyte recognition site in the preS1 domain of the large woodchuck hepatitis virus envelope protein.

    ID: 1350710

    Description: epitope description:MGNNIKVTFNPDKIAAWWPAVGTYY antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 8760435;

  4. Synthetic oligopeptides bearing a common or subtypic determinant of hepatitis B surface antigen.

    ID: 1350712

    Description: epitope description:TTSTGPCKTCTTPAQ antigen name:Large envelope protein host organism:Mus musculus antibody name:Mab 5124

    Publication: 1697880;

  5. Serologic response to the Borrelia burgdorferi flagellin demonstrates an epitope common to a neuroblastoma cell line.

    ID: 1350758

    Description: epitope description:LFSGEGAQTAQAAPVQEGVQQEGAQQPAPATAPSQGGVNSPVNVT antigen name:Flagellar filament 41 kDa core protein host organism:Homo sapiens

    Publication: 7678336;

  6. Serologic response to the Borrelia burgdorferi flagellin demonstrates an epitope common to a neuroblastoma cell line.

    ID: 1350770

    Description: epitope description:QQEGAQQPAPATA antigen name:Flagellar filament 41 kDa core protein host organism:Homo sapiens

    Publication: 7678336;

  7. Serologic response to the Borrelia burgdorferi flagellin demonstrates an epitope common to a neuroblastoma cell line.

    ID: 1350771

    Description: epitope description:QPAPATAPSQGGV antigen name:Flagellar filament 41 kDa core protein host organism:Homo sapiens

    Publication: 7678336;

  8. Serologic response to the Borrelia burgdorferi flagellin demonstrates an epitope common to a neuroblastoma cell line.

    ID: 1350772

    Description: epitope description:APSQGGVNSPVNV antigen name:Flagellar filament 41 kDa core protein host organism:Homo sapiens

    Publication: 7678336;

  9. Vaccine engineering: enhancement of immunogenicity of synthetic peptide vaccines related to hepatitis in chemically defined models consisting of T- an...

    ID: 1350799

    Description: epitope description:LQDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2480595;

  10. Vaccine engineering: enhancement of immunogenicity of synthetic peptide vaccines related to hepatitis in chemically defined models consisting of T- an...

    ID: 1350832

    Description: epitope description:LQDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2480595;

  11. Vaccine engineering: enhancement of immunogenicity of synthetic peptide vaccines related to hepatitis in chemically defined models consisting of T- an...

    ID: 1350848

    Description: epitope description:TKPTDGN antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2480595;

  12. Vaccine engineering: enhancement of immunogenicity of synthetic peptide vaccines related to hepatitis in chemically defined models consisting of T- an...

    ID: 1350850

    Description: epitope description:TKPTDGN antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2480595;

  13. Mapping of the T and B cell epitopes of the Mycobacterium bovis protein, MPB70.

    ID: 1350935

    Description: epitope description:GTRQTLQGASVTVTGQGNSLKVGNADVVCGGVSTANATVYMIDSVLMPPA antigen name:Immunogenic protein MPB70 host organism:Mus musculus antibody name...

    Publication: 1711006;

  14. Characterization of murine B-cell epitopes on the Mycobacterium leprae proline-rich antigen by use of synthetic peptides.

    ID: 1351140

    Description: epitope description:YPPP antigen name:Proline rich antigenic protein host organism:Mus musculus BALB/c antibody name:F67-1, F67-5

    Publication: 1702765;

  15. Allelic subtypic determinants of hepatitis B surface antigen (i and t) that are distinct from d/y or w/r.

    ID: 1351142

    Description: epitope description:TIPAQGTSM antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:I-18

    Publication: 7678309;

  16. Characterization of murine B-cell epitopes on the Mycobacterium leprae proline-rich antigen by use of synthetic peptides.

    ID: 1351149

    Description: epitope description:SYPPP antigen name:Proline rich antigenic protein host organism:Mus musculus BALB/c antibody name:F126-5

    Publication: 1702765;

  17. Allelic subtypic determinants of hepatitis B surface antigen (i and t) that are distinct from d/y or w/r.

    ID: 1351163

    Description: epitope description:TIPAQGTSM antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:I-18

    Publication: 7678309;

  18. Cross-reactive asparagine-rich determinants shared between several blood-stage antigens of Plasmodium falciparum and the circumsporozoite protein.

    ID: 1351267

    Description: epitope description:NPNANPNANPNANPNANPNANPNA antigen name:Circumsporozoite (CS) protein host organism:Aotus trivirgatus

    Publication: 1693414;

  19. Cross-reactive asparagine-rich determinants shared between several blood-stage antigens of Plasmodium falciparum and the circumsporozoite protein.

    ID: 1351270

    Description: epitope description:NNTNNTNNTNNTNNTNNTNNTNNT host organism:Aotus trivirgatus

    Publication: 1693414;

  20. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1351286

    Description: epitope description:SAPGGSNSTDDVLTRRWSTTNGSPK antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 7678097;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston