Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Prediction and characterization of the linear IgE epitopes for the major soybean allergen beta-conglycinin using immunoinformatics tools.

    ID: 1977311

    Description: epitope description:HEQREEQEWPRKEEKRGEKGSEEEDE antigen name:Beta-conglycinin, alpha chain (UniProt:P13916) host organism:Homo sapiens

    Publication: 23454299;

  2. Prediction and characterization of the linear IgE epitopes for the major soybean allergen beta-conglycinin using immunoinformatics tools.

    ID: 1977312

    Description: epitope description:DEEQQRESEESEDSELRRHKNKNPFL antigen name:Beta-conglycinin, alpha chain (UniProt:P13916) host organism:Homo sapiens

    Publication: 23454299;

  3. Prediction and characterization of the linear IgE epitopes for the major soybean allergen beta-conglycinin using immunoinformatics tools.

    ID: 1977322

    Description: epitope description:QRESYFVDAQPKKKEEGNKGRKGPLSSILR antigen name:Beta-conglycinin, alpha chain (UniProt:P13916) host organism:Homo sapiens

    Publication: 23454299;

  4. Mapping of the IgE and IgG4 sequential epitopes of ovomucoid with a peptide microarray immunoassay.

    ID: 1977323

    Description: epitope description:AEVDCSRFPNATDKEGKD antigen name:Gal d 1 host organism:Homo sapiens

    Publication: 23257567;

  5. Mapping of the IgE and IgG4 sequential epitopes of ovomucoid with a peptide microarray immunoassay.

    ID: 1977345

    Description: epitope description:PMNCSSYANTTSEDGKVMVL antigen name:Gal d 1 host organism:Homo sapiens

    Publication: 23257567;

  6. Mapping of the IgE and IgG4 sequential epitopes of ovomucoid with a peptide microarray immunoassay.

    ID: 1977356

    Description: epitope description:VTYDNECLLCAHKVEQGASV antigen name:Gal d 1 host organism:Homo sapiens

    Publication: 23257567;

  7. Mapping of the IgE and IgG4 sequential epitopes of ovomucoid with a peptide microarray immunoassay.

    ID: 1977358

    Description: epitope description:CLLCAHKVEQGASVDKRHDG antigen name:Gal d 1 host organism:Homo sapiens

    Publication: 23257567;

  8. Mapping of the IgE and IgG4 sequential epitopes of ovomucoid with a peptide microarray immunoassay.

    ID: 1977365

    Description: epitope description:CRKELAAVSVDCSEYPKPDC antigen name:Gal d 1 host organism:Homo sapiens

    Publication: 23257567;

  9. Mapping of the IgE and IgG4 sequential epitopes of ovomucoid with a peptide microarray immunoassay.

    ID: 1977367

    Description: epitope description:AVSVDCSEYPKPDCTAEDRP antigen name:Gal d 1 host organism:Homo sapiens

    Publication: 23257567;

  10. Mapping of the IgE and IgG4 sequential epitopes of ovomucoid with a peptide microarray immunoassay.

    ID: 1977371

    Description: epitope description:DCTAEDRPLCGSDNKTYGNK antigen name:Gal d 1 host organism:Homo sapiens

    Publication: 23257567;

  11. Mapping of the IgE and IgG4 sequential epitopes of ovomucoid with a peptide microarray immunoassay.

    ID: 1977377

    Description: epitope description:NKCNFCNAVVESNGTLTLSH antigen name:Gal d 1 host organism:Homo sapiens

    Publication: 23257567;

  12. Production and characterization of mouse monoclonal antibodies against lysis protein E of phiX174.

    ID: 1977449

    Description: epitope description:VRLKPLNCSR antigen name:Escherichia virus phiX174 protein host organism:Mus musculus BALB/c antibody name:E-A5

    Publication: 23523890;

  13. Production and characterization of mouse monoclonal antibodies against lysis protein E of phiX174.

    ID: 1977456

    Description: epitope description:VRLKPLNCSR antigen name:Escherichia virus phiX174 protein host organism:Mus musculus BALB/c antibody name:E-A5

    Publication: 23523890;

  14. Prediction and characterization of the linear IgE epitopes for the major soybean allergen beta-conglycinin using immunoinformatics tools.

    ID: 1977469

    Description: epitope description:SEDKPFNLRSRDPIYSNKLGKFFEITPEKN antigen name:Beta-conglycinin, alpha chain (UniProt:P13916) host organism:Homo sapiens

    Publication: 23454299;

  15. Immune responses elicited by apoB-100-derived peptides in mice.

    ID: 1977542

    Description: epitope description:IEIGLEGKGFEPTLEALFGK antigen name:Apolipoprotein B-100 host organism:Mus musculus Apolipoprotein E null

    Publication: 23345063;

  16. Intracellular accumulation of aggregated pyroglutamate amyloid beta: convergence of aging and Abeta pathology at the lysosome.

    ID: 1977544

    Description: epitope description:EFRHDS antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:6E10

    Publication: 22477259;

  17. Autoantibodies recognizing the amino terminal 1-17 segment of CENP-A display unique specificities in systemic sclerosis.

    ID: 1977633

    Description: epitope description:MGPRRRSRKPEAPRRRS antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

    Publication: 23613856;

  18. Structure of a classical broadly neutralizing stem antibody in complex with a pandemic H2 influenza virus hemagglutinin.

    ID: 1977786

    Description: epitope description:A: H43, K45, I47, T302, L303, P304, T329; B: V358, D359, G360, W361, K378, T381, Q382, K383, F385, D386, V392, I396 antigen name:H...

    Publication: 23552413;

  19. Structure of a classical broadly neutralizing stem antibody in complex with a pandemic H2 influenza virus hemagglutinin.

    ID: 1977790

    Description: epitope description:A: H43, K45, I47, T302, L303, P304, T329; B: V358, D359, G360, W361, K378, T381, Q382, K383, F385, D386, V392, I396 antigen name:H...

    Publication: 23552413;

  20. Structure of a classical broadly neutralizing stem antibody in complex with a pandemic H2 influenza virus hemagglutinin.

    ID: 1977794

    Description: epitope description:A: H43, K45, I47, T302, L303, P304, T329; B: V358, D359, G360, W361, K378, T381, Q382, K383, F385, D386, V392, I396 antigen name:H...

    Publication: 23552413;

  21. Structure of a classical broadly neutralizing stem antibody in complex with a pandemic H2 influenza virus hemagglutinin.

    ID: 1977798

    Description: epitope description:A: H43, K45, I47, T302, L303, P304, T329; B: V358, D359, G360, W361, K378, T381, Q382, K383, F385, D386, V392, I396 antigen name:H...

    Publication: 23552413;

  22. Structure of a classical broadly neutralizing stem antibody in complex with a pandemic H2 influenza virus hemagglutinin.

    ID: 1977800

    Description: epitope description:A: H43, K45, I47, T302, L303, P304, T329; B: V358, D359, G360, W361, K378, T381, Q382, K383, F385, D386, V392, I396 antigen name:H...

    Publication: 23552413;

  23. Structure of a classical broadly neutralizing stem antibody in complex with a pandemic H2 influenza virus hemagglutinin.

    ID: 1977803

    Description: epitope description:A: H43, K45, I47, T302, L303, P304, T329; B: V358, D359, G360, W361, K378, T381, Q382, K383, F385, D386, V392, I396 antigen name:H...

    Publication: 23552413;

  24. Multiple sites of the cleavage of 21- and 25-mer encephalytogenic oligopeptides corresponding to human myelin basic protein (MBP) by specific anti-MBP...

    ID: 1975124

    Description: epitope description:YLASASTMDHARHGFLPRRHR antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

    Publication: 23520443;

  25. Multiple sites of the cleavage of 21- and 25-mer encephalytogenic oligopeptides corresponding to human myelin basic protein (MBP) by specific anti-MBP...

    ID: 1975126

    Description: epitope description:YLASASTMDHARHGFLPRRHR antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

    Publication: 23520443;

  26. Multiple sites of the cleavage of 21- and 25-mer encephalytogenic oligopeptides corresponding to human myelin basic protein (MBP) by specific anti-MBP...

    ID: 1975128

    Description: epitope description:AQGTLSKIFKLGGRDSRSGSPMARR antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

    Publication: 23520443;

  27. Multiple sites of the cleavage of 21- and 25-mer encephalytogenic oligopeptides corresponding to human myelin basic protein (MBP) by specific anti-MBP...

    ID: 1975129

    Description: epitope description:AQGTLSKIFKLGGRDSRSGSPMARR antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

    Publication: 23520443;

  28. Effects of amino acid substitutions in the VP2 B-C loop on antigenicity and pathogenicity of serotype Asia1 foot-and-mouth disease virus.

    ID: 1975134

    Description: epitope description:D358 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1B4

    Publication: 22963009;

  29. Mucosal tolerance to a combination of ApoB and HSP60 peptides controls plaque progression and stabilizes vulnerable plaque in Apob(tm2Sgy)Ldlr(tm1Her)...

    ID: 1975138

    Description: epitope description:IEIGLEGKGFEPTLEALFGK antigen name:Apolipoprotein B-100 host organism:Mus musculus Apolipoprotein B null

    Publication: 23505495;

  30. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme...

    ID: 1975147

    Description: epitope description:TDELNQQRDDITRAI antigen name:Possible Mce-family lipoprotein LprK (Mce-family lipoprotein Mce1E) host organism:Oryctolagus cunicul...

    Publication: 10564555;

  31. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme...

    ID: 1975149

    Description: epitope description:TDELNQQRDDITRAI antigen name:Possible Mce-family lipoprotein LprK (Mce-family lipoprotein Mce1E) host organism:Oryctolagus cunicul...

    Publication: 10564555;

  32. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975167

    Description: epitope description:LIPLMALSTI antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  33. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975173

    Description: epitope description:SSTGNLEVIQ antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  34. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975186

    Description: epitope description:SQGLLGYYFS antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  35. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975198

    Description: epitope description:TGDLSIPSSE antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  36. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975199

    Description: epitope description:DLSIPSSELE antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  37. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975207

    Description: epitope description:QYFQSAIWSG antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  38. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975210

    Description: epitope description:IWSGFIKVKK antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  39. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975215

    Description: epitope description:SDEYTFATSA antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  40. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975222

    Description: epitope description:TMWVDDQEVI antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  41. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975229

    Description: epitope description:NSNKIRLEKG antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  42. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975230

    Description: epitope description:NKIRLEKGRL antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  43. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975231

    Description: epitope description:IRLEKGRLYQ antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  44. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975232

    Description: epitope description:LEKGRLYQIK antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  45. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975237

    Description: epitope description:IQYQRENPTE antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  46. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975246

    Description: epitope description:WTDSQNKKEV antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  47. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975248

    Description: epitope description:QNKKEVISSD antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  48. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975250

    Description: epitope description:EVISSDNLQL antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  49. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975257

    Description: epitope description:QKSSNSRKKR antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;

  50. Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

    ID: 1975260

    Description: epitope description:RKKRSTSAGP antigen name:Protective antigen host organism:Mus musculus A/J

    Publication: 23415781;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston