Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "
  1. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482502

    Description: epitope description:DFGSLAPRVA antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 10501234;
  2. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482510

    Description: epitope description:DFGSLAPRVA antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 10501234;
  3. Priming for and induction of anti-poliovirus neutralizing antibodies by synthetic peptides.

    ID: 1482513

    Description: epitope description:STTNKDK antigen name:Genome polyprotein host organism:Mus musculus antibody name:1 BM 55-6

    Publication: 6310403;
  4. Characterization of HTLV envelope seroreactivity in large granular lymphocyte leukemia.

    ID: 1482520

    Description: epitope description:QEQCRFPNITNSHVSILQERPPLENRVLTGWGLN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 15725471;
  5. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482531

    Description: epitope description:NLRGDLQVLA antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 10501234;

Displaying 5 of 1,510,353 results for " "