Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465055

    Description: epitope description:DLVKFISDKIKFLNP antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  2. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465058

    Description: epitope description:AKWAVPTTRTDDKLR antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  3. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465061

    Description: epitope description:LCENPEWAPLKDNRI antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  4. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465063

    Description: epitope description:PLITHGSGMDLYKSN antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  5. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465064

    Description: epitope description:FNVPIKEAGEDCHAP antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  6. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465066

    Description: epitope description:YSPSRSFSYFYPFRL antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  7. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465068

    Description: epitope description:LIGLLAIAGIRLHRAAIYTAEIHK antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  8. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465084

    Description: epitope description:TSQGMYGGTYLVEKP antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  9. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465089

    Description: epitope description:TNYLEQPVSNDLSNC antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  10. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465090

    Description: epitope description:DLSNCMVALGELKLA antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  11. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465092

    Description: epitope description:EDSITIPYQGSGKGV antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  12. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465099

    Description: epitope description:DDKLRMETCFQQACK antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  13. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465110

    Description: epitope description:FNVPIKEAGEDCHAP antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  14. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465119

    Description: epitope description:WDQKLWCRHFCVLAD antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  15. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465120

    Description: epitope description:CVLADSESGGHITHS antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  16. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465122

    Description: epitope description:GVSCTVTREDGTNRR antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  17. Diagnostic value of a synthetic peptide derived from Echinococcus granulosus recombinant protein.

    ID: 1465131

    Description: epitope description:EFIRKYDKGNKGKINLEELTAMLDSVHRKTSRASMSR antigen name:Calcium-binding protein host organism:Mus musculus BALB/c antibody name:EG 02 1...

    Publication: 1737836;

  18. Functional selection of vaccine candidate peptides from Staphylococcus aureus whole-genome expression libraries in vitro.

    ID: 1465135

    Description: epitope description:KFNPDLAPG antigen name:Surface protein G host organism:Homo sapiens

    Publication: 12874343;

  19. Diagnostic value of a synthetic peptide derived from Echinococcus granulosus recombinant protein.

    ID: 1465165

    Description: epitope description:EAQKAKTKLEEVRLDLDSDKTKLKNAKTAEQKAK antigen name:Hydatid disease diagnostic antigen P-29 host organism:Homo sapiens

    Publication: 1737836;

  20. Diagnostic value of a synthetic peptide derived from Echinococcus granulosus recombinant protein.

    ID: 1465205

    Description: epitope description:EAQKAKTKLEEVRLDLDSDKTKLKNAKTAEQKAK antigen name:Hydatid disease diagnostic antigen P-29 host organism:Homo sapiens

    Publication: 1737836;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston