Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482297

    Description: epitope description:RHVNAGSTGPIKSTI antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7513917;

  2. Neutralizing epitopes of type O foot-and-mouth disease virus. II. Mapping three conformational sites with synthetic peptide reagents.

    ID: 1482306

    Description: epitope description:N143, L144, R145, G146, R200, H201, K202, Q203, K204, I205, V206, A207, P208, V209, K210, Q211, T212, L213 antigen name:Genome po...

    Publication: 2471812;

  3. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482314

    Description: epitope description:YSRNAVPNLRGDLQVLAQKVARTLPTSFNY antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  4. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482317

    Description: epitope description:YSRNAVPNLRGDLQVLAQKVARTLPTSFNY antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  5. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482318

    Description: epitope description:YSRNAVPNLRGDLQVLAQKVARTLPTSFNY antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  6. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482348

    Description: epitope description:IKSTIRIYFKPKHVK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7513917;

  7. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482353

    Description: epitope description:TAYTASARRGDLAHLAAAHARHLPTSFNF antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  8. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482355

    Description: epitope description:TAYTASARRGDLAHLAAAHARHLPTSFNF antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  9. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482357

    Description: epitope description:TAYTASARRGDLAHLAAAHARHLPTSFNF antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  10. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482360

    Description: epitope description:YKPTGTAPRENIRGDLATLAARIASETHIPTTFNY antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:ant...

    Publication: 2155177;

  11. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482364

    Description: epitope description:YKPTGTAPRENIRGDLATLAARIASETHIPTTFNY antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:ant...

    Publication: 2155177;

  12. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482377

    Description: epitope description:YGEEPTMRGDRAVLASKVNKQLPTSFNY antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-pepti...

    Publication: 2155177;

  13. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482387

    Description: epitope description:GPTEESVERAMGRVA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7513917;

  14. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482394

    Description: epitope description:IKSTIRIYFKPKHVK antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 7513917;

  15. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482401

    Description: epitope description:GPSNSEQIPALTAVE antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 7513917;

  16. Linear antigenic and immunogenic regions of the respiratory syncytial virus P protein.

    ID: 1482412

    Description: epitope description:PTPSDNPFSKLYKETIETFD antigen name:Phosphoprotein host organism:Mus musculus antibody name:RS203

    Publication: 8207401;

  17. Linear antigenic and immunogenic regions of the respiratory syncytial virus P protein.

    ID: 1482414

    Description: epitope description:PTPSDNPFSKLYKETIETFD antigen name:Phosphoprotein host organism:Homo sapiens

    Publication: 8207401;

  18. Linear antigenic and immunogenic regions of the respiratory syncytial virus P protein.

    ID: 1482418

    Description: epitope description:EKLNNLLEGNDSDNDLSLEDF antigen name:Phosphoprotein host organism:Homo sapiens

    Publication: 8207401;

  19. Failure to detect evidence of human T-lymphotropic virus (HTLV) type I and type II in blood donors with isolated gag antibodies to HTLV-I/II.

    ID: 1482441

    Description: epitope description:PPSSPTHDPPDSDPQI antigen name:Gag-Pro-Pol polyprotein host organism:Homo sapiens

    Publication: 1627806;

  20. Location of neutralizing epitopes defined by monoclonal antibodies generated against the outer capsid polypeptide, VP1, of foot-and-mouth disease viru...

    ID: 1482478

    Description: epitope description:GDFGSLAPRVARQLPASFNYGAIK antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:6HE4, 7SF3

    Publication: 6085200;

  21. Location of neutralizing epitopes defined by monoclonal antibodies generated against the outer capsid polypeptide, VP1, of foot-and-mouth disease viru...

    ID: 1482481

    Description: epitope description:GDFGSLAPRVARQLPASFNYGAIK antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:6HE4, 7SF3

    Publication: 6085200;

  22. Binding of neutralizing monoclonal antibodies to regions of the fusion protein of respiratory syncytial virus expressed in Escherichia coli.

    ID: 1482488

    Description: epitope description:PITNDQKK antigen name:Fusion glycoprotein F0 host organism:Mus musculus antibody name:RS348

    Publication: 7506297;

  23. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482491

    Description: epitope description:GSGVRGDFG antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  24. Influence of the C terminus of the small protein subunit of bean pod mottle virus on the antigenicity of the virus determined using monoclonal antibod...

    ID: 1482495

    Description: epitope description:AFSVPQANARSSENAESSA antigen name:RNA2 polyprotein host organism:Oryctolagus cuniculus antibody name:anti-180-198

    Publication: 1716655;

  25. Influence of the C terminus of the small protein subunit of bean pod mottle virus on the antigenicity of the virus determined using monoclonal antibod...

    ID: 1482499

    Description: epitope description:ANARSSENAESSA antigen name:RNA2 polyprotein host organism:Oryctolagus cuniculus antibody name:anti-186-198

    Publication: 1716655;

  26. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482502

    Description: epitope description:DFGSLAPRVA antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  27. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482510

    Description: epitope description:DFGSLAPRVA antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  28. Priming for and induction of anti-poliovirus neutralizing antibodies by synthetic peptides.

    ID: 1482513

    Description: epitope description:STTNKDK antigen name:Genome polyprotein host organism:Mus musculus antibody name:1 BM 55-6

    Publication: 6310403;

  29. Characterization of HTLV envelope seroreactivity in large granular lymphocyte leukemia.

    ID: 1482520

    Description: epitope description:QEQCRFPNITNSHVSILQERPPLENRVLTGWGLN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 15725471;

  30. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482531

    Description: epitope description:NLRGDLQVLA antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  31. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482539

    Description: epitope description:DLQVLAQKVA antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  32. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482544

    Description: epitope description:VLAQKVARTL antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 10501234;

  33. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482558

    Description: epitope description:PNLRGDLQVL antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 10501234;

  34. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482559

    Description: epitope description:NLRGDLQVLA antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  35. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482560

    Description: epitope description:NLRGDLQVLA antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 10501234;

  36. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482564

    Description: epitope description:RGDLQVLAQK antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 10501234;

  37. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482565

    Description: epitope description:RDALPNTEASGPTHSKE antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  38. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482572

    Description: epitope description:RYNRNAVPNL antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  39. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482573

    Description: epitope description:RDALPNTEASGPTHSKE antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  40. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482577

    Description: epitope description:DLQVLAQKVA antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 10501234;

  41. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482587

    Description: epitope description:VRGDFGSLAP antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 10501234;

  42. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482590

    Description: epitope description:GDFGSLAPRV antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  43. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482593

    Description: epitope description:DFGSLAPRVA antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 10501234;

  44. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482595

    Description: epitope description:FGSLAPRVAR antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 10501234;

  45. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482613

    Description: epitope description:PPGAPVPEKWDDYTWQTSSNP antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  46. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482614

    Description: epitope description:SIFYTYGTAPARISVPYVGI antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  47. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482621

    Description: epitope description:VVNDHNPTKVTSKIRVYLKPK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  48. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475634

    Description: epitope description:PSTYQEPQESQQRGR antigen name:Glycinin G2 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 11112857;

  49. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475636

    Description: epitope description:QRPQDRHQKVHRFRE antigen name:Glycinin G2 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 11112857;

  50. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475639

    Description: epitope description:AWWMYNNEDTPVVAV antigen name:Glycinin G2 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 11112857;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston