Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Influence of immunoadjuvants and a promiscous T-cell determinant on the immunogenicity of RESA peptide antigen of P. falciparum.

    ID: 1349290

    Description: epitope description:EENVEHDAEENVEHDA antigen name:DNAJ protein, putative host organism:Mus musculus SJL

    Publication: 9754674;

  2. In human malaria protective antibodies are directed mainly against the Lys-Glu ion pair within the Lys-Glu-Lys motif of the synthetic vaccine SPf 66.

    ID: 1349300

    Description: epitope description:YSLFQKEK antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 1557226;

  3. In human malaria protective antibodies are directed mainly against the Lys-Glu ion pair within the Lys-Glu-Lys motif of the synthetic vaccine SPf 66.

    ID: 1349307

    Description: epitope description:VDYLEEKTKDQDL antigen name:Rhoptry-associated protein 1, RAP1 host organism:Homo sapiens

    Publication: 1557226;

  4. Antigenicity and immunogenicity of multiple antigen peptides (MAP) containing P. vivax CS epitopes in Aotus monkeys.

    ID: 1349326

    Description: epitope description:FNNFTVSFWLRVPKVSASHLE antigen name:Tetanus toxin host organism:Aotus lemurinus antibody name:anti-MAP IV

    Publication: 9149283;

  5. Antigenicity and immunogenicity of multiple antigen peptides (MAP) containing P. vivax CS epitopes in Aotus monkeys.

    ID: 1349330

    Description: epitope description:GDRADGQPAGDRADGQPAGDRADGQPAGDRADGQPA antigen name:Circumsporozoite protein, putative host organism:Aotus lemurinus antibody name:a...

    Publication: 9149283;

  6. Antigenicity and immunogenicity of multiple antigen peptides (MAP) containing P. vivax CS epitopes in Aotus monkeys.

    ID: 1349333

    Description: epitope description:GDRADGQPAGDRADGQPAGDRADGQPAGDRADGQPA antigen name:Circumsporozoite protein, putative host organism:Aotus lemurinus antibody name:a...

    Publication: 9149283;

  7. Antigenicity and immunogenicity of multiple antigen peptides (MAP) containing P. vivax CS epitopes in Aotus monkeys.

    ID: 1349334

    Description: epitope description:GDRADGQPAGDRADGQPAGDRADGQPAGDRADGQPA antigen name:Circumsporozoite protein, putative host organism:Aotus lemurinus antibody name:a...

    Publication: 9149283;

  8. Hepatitis B virus vaccine: identification of HBsAg/a and HBsAg/d but not HBsAg/y subtype antigenic determinants on a synthetic immunogenic peptide.

    ID: 1349382

    Description: epitope description:KPTDGN antigen name:Large envelope protein host organism:Mus musculus antibody name:Anti-HBsAg

    Publication: 6176997;

  9. Antigenicity and immunogenicity of multiple antigen peptides (MAP) containing P. vivax CS epitopes in Aotus monkeys.

    ID: 1349391

    Description: epitope description:GDRADGQPAGDRADGQPAGDRADGQPAGDRADGQPA antigen name:Circumsporozoite protein, putative host organism:Aotus lemurinus antibody name:a...

    Publication: 9149283;

  10. Antigenicity and immunogenicity of multiple antigen peptides (MAP) containing P. vivax CS epitopes in Aotus monkeys.

    ID: 1349415

    Description: epitope description:GDRADGQPAGDRADGQPAGDRADGQPAGDRADGQPA antigen name:Circumsporozoite protein, putative host organism:Aotus lemurinus antibody name:a...

    Publication: 9149283;

  11. Immunological cross-reactivity between preS2 sequences of the hepatitis B virus envelope proteins corresponding to serological subtypes adw2 and ayw.

    ID: 1349471

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbit se...

    Publication: 3657796;

  12. Recognition of Mycobacterium leprae recombinant 18,000 MW epitopes by IgG subclasses in leprosy.

    ID: 1352999

    Description: epitope description:DSLDIDIERNVVTVR antigen name:UniProt:B8ZS71 host organism:Homo sapiens

    Publication: 7538491;

  13. Orientation of epitopes influences the immunogenicity of synthetic peptide dimers.

    ID: 1353003

    Description: epitope description:YEKIGAELVKEVAKKTDDVAG antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus

    Publication: 2464496;

  14. Orientation of epitopes influences the immunogenicity of synthetic peptide dimers.

    ID: 1353008

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 2464496;

  15. Fine mapping of virus-neutralizing epitopes on hepatitis B virus PreS1.

    ID: 1353016

    Description: epitope description:NSNNPDWDF antigen name:Large envelope protein host organism:Mus musculus antibody name:KR127

    Publication: 10772975;

  16. Recognition of Mycobacterium leprae recombinant 18,000 MW epitopes by IgG subclasses in leprosy.

    ID: 1353031

    Description: epitope description:VVTVRAERPGVDPDR antigen name:UniProt:B8ZS71 host organism:Homo sapiens

    Publication: 7538491;

  17. Recognition of Mycobacterium leprae recombinant 18,000 MW epitopes by IgG subclasses in leprosy.

    ID: 1353032

    Description: epitope description:VVTVRAERPGVDPDR antigen name:UniProt:B8ZS71 host organism:Homo sapiens

    Publication: 7538491;

  18. Recognition of Mycobacterium leprae recombinant 18,000 MW epitopes by IgG subclasses in leprosy.

    ID: 1353043

    Description: epitope description:QLVLGENLDTERILAS antigen name:UniProt:B8ZS71 host organism:Homo sapiens

    Publication: 7538491;

  19. Orientation of epitopes influences the immunogenicity of synthetic peptide dimers.

    ID: 1353052

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Genome polyprotein host organism:Mus musculus B10.BR

    Publication: 2464496;

  20. Recognition of Mycobacterium leprae recombinant 18,000 MW epitopes by IgG subclasses in leprosy.

    ID: 1353054

    Description: epitope description:LKLSIPVAERAKPRK antigen name:UniProt:B8ZS71 host organism:Homo sapiens

    Publication: 7538491;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston