Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Identification of epitopes of the beta subunit of soybean beta-conglycinin that are antigenic in pigs, dogs, rabbits and fish.

    ID: 2110562

    Description: epitope description:QQSYLQGFSHNILETS antigen name:Beta-conglycinin, beta chain host organism:Morone chrysops x Morone saxatilis

    Publication: 24415270;

  2. Identification of epitopes of the beta subunit of soybean beta-conglycinin that are antigenic in pigs, dogs, rabbits and fish.

    ID: 2110570

    Description: epitope description:VIVELSKEQIRQLSRR antigen name:Beta-conglycinin, beta chain host organism:Morone chrysops x Morone saxatilis

    Publication: 24415270;

  3. Identification of epitopes of the beta subunit of soybean beta-conglycinin that are antigenic in pigs, dogs, rabbits and fish.

    ID: 2110578

    Description: epitope description:YSNNFGKFFEITPEKN antigen name:Beta-conglycinin, beta chain host organism:Morone chrysops x Morone saxatilis

    Publication: 24415270;

  4. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114394

    Description: epitope description:TETDIKIMERVVE antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus PrP null

    Publication: 24117858;

  5. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114396

    Description: epitope description:TDIKIMERVVEQM antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus PrP null

    Publication: 24117858;

  6. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114397

    Description: epitope description:TDIKIMERVVEQM antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus PrP null

    Publication: 24117858;

  7. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114399

    Description: epitope description:IKIMERVVEQMCT antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus PrP null

    Publication: 24117858;

  8. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114402

    Description: epitope description:ERVVEQMCTTQYQ antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus PrP null

    Publication: 24117858;

  9. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114403

    Description: epitope description:ERVVEQMCTTQYQ antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus PrP null

    Publication: 24117858;

  10. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114405

    Description: epitope description:VVEQMCTTQYQKE antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus PrP null

    Publication: 24117858;

  11. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114423

    Description: epitope description:DGRRSSAVLFSSP antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus PrP null

    Publication: 24117858;

  12. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114424

    Description: epitope description:RRSSAVLFSSPPV antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus PrP null

    Publication: 24117858;

  13. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114426

    Description: epitope description:SSAVLFSSPPVIL antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus PrP null

    Publication: 24117858;

  14. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114437

    Description: epitope description:VILLISFLIFLMV antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus PrP null

    Publication: 24117858;

  15. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114445

    Description: epitope description:WEDRYY antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus PrP null

    Publication: 24117858;

  16. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114452

    Description: epitope description:DGR antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  17. Deimination of linker histones links neutrophil extracellular trap release with autoantibodies in systemic autoimmunity.

    ID: 2114458

    Description: epitope description:KAVAASKERSGVSLAA + CITR(R9) antigen name:Histone H1.2 host organism:Homo sapiens

    Publication: 24671707;

  18. Oral dosing with multi-antigenic construct induces atheroprotective immune tolerance to individual peptides in mice.

    ID: 2114473

    Description: epitope description:IEIGLEGKGFEPTLEALFGK antigen name:Apolipoprotein B-100 host organism:Mus musculus C57BL/6

    Publication: 24962340;

  19. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114484

    Description: epitope description:GSRYPGQGSPGGNRYPPQG antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  20. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114487

    Description: epitope description:QGSPGGN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:3H2

    Publication: 24117858;

  21. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114495

    Description: epitope description:EDRYYRE antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:1F5

    Publication: 24117858;

  22. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114497

    Description: epitope description:EDRYYRE antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:1F5

    Publication: 24117858;

  23. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2114501

    Description: epitope description:YYRPVDQYSNQNN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:1F5

    Publication: 24117858;

  24. Influenza hemagglutinin stem-fragment immunogen elicits broadly neutralizing antibodies and confers heterologous protection.

    ID: 2114728

    Description: epitope description:A: H24, H44, Q46, S304, M305, B: V364, D365, G366, W367, K384, T387, Q388, I391, T395, V398, N399, I402 antigen name:Hemagglutinin...

    Publication: 24927560;

  25. Influenza hemagglutinin stem-fragment immunogen elicits broadly neutralizing antibodies and confers heterologous protection.

    ID: 2114729

    Description: epitope description:A: H24, H44, Q46, S304, M305, B: V364, D365, G366, W367, K384, T387, Q388, I391, T395, V398, N399, I402 antigen name:Hemagglutinin...

    Publication: 24927560;

  26. Comparative analysis of collagen type II-specific immune responses during development of collagen-induced arthritis in two B10 mouse strains.

    ID: 2115627

    Description: epitope description:GLVGPRGERGF antigen name:Collagen alpha-1(II) chain host organism:Mus musculus HLA-DRA*0101/HLA-DRB*0401

    Publication: 23116329;

  27. Comparative analysis of collagen type II-specific immune responses during development of collagen-induced arthritis in two B10 mouse strains.

    ID: 2115631

    Description: epitope description:GARGLTGRPGDA antigen name:Collagen alpha-1(II) chain host organism:Mus musculus HLA-DRA*0101/HLA-DRB*0401

    Publication: 23116329;

  28. Comparative analysis of collagen type II-specific immune responses during development of collagen-induced arthritis in two B10 mouse strains.

    ID: 2115644

    Description: epitope description:GERGAAGIAGPK antigen name:Collagen alpha-1(II) chain host organism:Mus musculus HLA-DRA*0101/HLA-DRB*0401

    Publication: 23116329;

  29. Clinical correlates of a subset of anti-CENP-A antibodies cross-reacting with FOXE3p53-62 in systemic sclerosis.

    ID: 2115653

    Description: epitope description:MGPRRRSRKPEAPRRRS antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

    Publication: 23837651;

  30. Clinical correlates of a subset of anti-CENP-A antibodies cross-reacting with FOXE3p53-62 in systemic sclerosis.

    ID: 2115654

    Description: epitope description:SPSPTPTPGPSRRG antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

    Publication: 23837651;

  31. Clinical correlates of a subset of anti-CENP-A antibodies cross-reacting with FOXE3p53-62 in systemic sclerosis.

    ID: 2115658

    Description: epitope description:PTPAPGPGRR antigen name:Forkhead box protein E3 host organism:Homo sapiens

    Publication: 23837651;

  32. Epitope Mapping of Antibodies to Alpha-Synuclein in LRRK2 Mutation Carriers, Idiopathic Parkinson Disease Patients, and Healthy Controls.

    ID: 2115664

    Description: epitope description:QEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA antigen name:Alpha-synuclein host organism:Homo sapiens

    Publication: 25076905;

  33. Epitope Mapping of Antibodies to Alpha-Synuclein in LRRK2 Mutation Carriers, Idiopathic Parkinson Disease Patients, and Healthy Controls.

    ID: 2115666

    Description: epitope description:EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAP antigen name:Alpha-synuclein host organism:Homo sapiens

    Publication: 25076905;

  34. Identification and characterization of a multispecific monoclonal antibody G2 against chicken prion protein.

    ID: 2115669

    Description: epitope description:EAVAAANQTEVEMENKVV antigen name:Major prion protein homolog host organism:Mus musculus BALB/c antibody name:G2

    Publication: 24863561;

  35. Identification and characterization of a multispecific monoclonal antibody G2 against chicken prion protein.

    ID: 2115670

    Description: epitope description:EAVAAANQTEVEMENKVV antigen name:Major prion protein homolog host organism:Mus musculus BALB/c antibody name:G2

    Publication: 24863561;

  36. Identification and characterization of a multispecific monoclonal antibody G2 against chicken prion protein.

    ID: 2115675

    Description: epitope description:EAVAAANQTEVEMENKVV antigen name:Major prion protein homolog host organism:Mus musculus BALB/c antibody name:G2

    Publication: 24863561;

  37. Identification and characterization of a multispecific monoclonal antibody G2 against chicken prion protein.

    ID: 2115690

    Description: epitope description:ANQTEV antigen name:Major prion protein homolog host organism:Mus musculus BALB/c antibody name:D8-3D

    Publication: 24863561;

  38. Validation of a multiplex chip-based assay for the detection of autoantibodies against citrullinated peptides.

    ID: 2116093

    Description: epitope description:APPPISGGGYRARPAKAAAT + CITR(R11) antigen name:Fibrinogen beta chain host organism:Homo sapiens

    Publication: 23025688;

  39. Validation of a multiplex chip-based assay for the detection of autoantibodies against citrullinated peptides.

    ID: 2116098

    Description: epitope description:GARGLTGRPGDA + CITR(R3, R8) antigen name:Collagen alpha-1(II) chain host organism:Homo sapiens

    Publication: 23025688;

  40. Specific binding of intravenous immunoglobulin products to tau peptide fragments.

    ID: 2116131

    Description: epitope description:VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS antigen name:Microtubule-associated protein tau host organism:Homo sapiens

    Publication: 24859060;

  41. Specific binding of intravenous immunoglobulin products to tau peptide fragments.

    ID: 2116133

    Description: epitope description:VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN antigen name:Microtubule-associated protein tau host organism:Homo sapiens

    Publication: 24859060;

  42. Characterization of immunological cross-reactivity between enterotoxigenic Escherichia coli heat-stable toxin and human guanylin and uroguanylin.

    ID: 2116134

    Description: epitope description:NSSNYCCELCCNPACTGCY antigen name:Heat-stable enterotoxin A2 (STA2) host organism:Mus musculus BALB/c antibody name:ST:G8

    Publication: 24778111;

  43. Generation of neutralizing monoclonal antibodies against a conformational epitope of human adenovirus type 7 (HAdv-7) incorporated in capsid encoded i...

    ID: 2116214

    Description: epitope description:FDGREAADAFSPEIV antigen name:hexon (GenPept:56160887) host organism:Mus musculus BALB/c

    Publication: 25054273;

  44. Synthetic peptides for efficient discrimination of anti-enterovirus antibodies at the serotype level.

    ID: 2116228

    Description: epitope description:GDPIADMIDQTVNNQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24929043;

  45. Synthetic peptides for efficient discrimination of anti-enterovirus antibodies at the serotype level.

    ID: 2116231

    Description: epitope description:NSWGSQMDLTDPLCI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24929043;

  46. Synthetic peptides for efficient discrimination of anti-enterovirus antibodies at the serotype level.

    ID: 2116237

    Description: epitope description:NDVRQAVEGAIGRVA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24929043;

  47. Immunoglobulin E epitope mapping by microarray immunoassay reveals differences in immune response to genetic variants of caseins from different rumina...

    ID: 2116272

    Description: epitope description:KEDVPSERYLGYLEQLLRLK antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24485684;

  48. Immunoglobulin E epitope mapping by microarray immunoassay reveals differences in immune response to genetic variants of caseins from different rumina...

    ID: 2116279

    Description: epitope description:YPSGAWYYVPLGTQYP antigen name:Bubalus bubalis (domestic water buffalo) protein host organism:Homo sapiens

    Publication: 24485684;

  49. Immunoglobulin E epitope mapping by microarray immunoassay reveals differences in immune response to genetic variants of caseins from different rumina...

    ID: 2116285

    Description: epitope description:DAPSFSDIPNPIGSENSGKT antigen name:Bubalus bubalis (domestic water buffalo) protein host organism:Homo sapiens

    Publication: 24485684;

  50. Immunoglobulin E epitope mapping by microarray immunoassay reveals differences in immune response to genetic variants of caseins from different rumina...

    ID: 2116289

    Description: epitope description:TDAPSFSDIPNPIGSENSEK antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24485684;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston