Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. A G-quadruplex-containing RNA activates fluorescence in a GFP-like fluorophore.

    ID: 2116307

    Description: epitope description:5'-GAAACAC-3' RNA fragment host organism:Mus musculus antibody name:BL3-6

    Publication: 24952597;

  2. A G-quadruplex-containing RNA activates fluorescence in a GFP-like fluorophore.

    ID: 2116308

    Description: epitope description:5'-GAAACAC-3' RNA fragment host organism:Mus musculus antibody name:BL3-6

    Publication: 24952597;

  3. Immunoglobulin E epitope mapping by microarray immunoassay reveals differences in immune response to genetic variants of caseins from different rumina...

    ID: 2116319

    Description: epitope description:PFPKYPVEPFTESQSL antigen name:Bos d 11 host organism:Homo sapiens

    Publication: 24485684;

  4. Immunoglobulin E epitope mapping by microarray immunoassay reveals differences in immune response to genetic variants of caseins from different rumina...

    ID: 2116326

    Description: epitope description:KYIPIQYVLSRYPSYGLNYY antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 24485684;

  5. Immunoglobulin E epitope mapping by microarray immunoassay reveals differences in immune response to genetic variants of caseins from different rumina...

    ID: 2116329

    Description: epitope description:ALINNQFLPYPYYAKPAAVR antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 24485684;

  6. Immunoglobulin E epitope mapping by microarray immunoassay reveals differences in immune response to genetic variants of caseins from different rumina...

    ID: 2116330

    Description: epitope description:SDIPNPIGSENSEK antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24485684;

  7. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2116337

    Description: epitope description:GRKTASFTVSSEKTILTM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  8. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2116988

    Description: epitope description:ENPAKTREYCLHAKLSDT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  9. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2116997

    Description: epitope description:GLLVISGLFPVSIPITAA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  10. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2117000

    Description: epitope description:LALPWKHEGAQNWNNAER antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  11. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2117008

    Description: epitope description:PWLAWHVAANVSSVTDRS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  12. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2117010

    Description: epitope description:SEWTNVDIQPARSWGTYV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  13. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2117013

    Description: epitope description:WSIHASGAWMTTEDMLDV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  14. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2117022

    Description: epitope description:SEWTNVDIQPARSWGTYV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  15. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2117030

    Description: epitope description:GLNTFTNMEAQLIRQMEG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  16. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2117055

    Description: epitope description:CGLFGKGSIVACVKAACE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  17. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2117057

    Description: epitope description:EFGAPHAVKMDVYNLGDQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  18. Immunoglobulin E epitope mapping by microarray immunoassay reveals differences in immune response to genetic variants of caseins from different rumina...

    ID: 2117075

    Description: epitope description:SISSSEEIVPISVEQ antigen name:Bubalus bubalis (domestic water buffalo) protein host organism:Homo sapiens

    Publication: 24485684;

  19. Immunoglobulin E epitope mapping by microarray immunoassay reveals differences in immune response to genetic variants of caseins from different rumina...

    ID: 2117087

    Description: epitope description:SSEESITRINKKIEKFQSEE + PHOS(S18) antigen name:Bos d 11 host organism:Homo sapiens

    Publication: 24485684;

  20. Identification of a free core B-cell epitope in the lipopolysaccharide of Francisella tularensis

    ID: 2117114

    Description: epitope description:alpha-D-GalNAc-(1->2)-beta-D-Man-(1->4)-[beta-D-Glc-(1->2)]-alpha-D-Man-(1->5)-alpha-Kdo antigen name:lipopolysaccharide host orga...

  21. Identification of a free core B-cell epitope in the lipopolysaccharide of Francisella tularensis

    ID: 2117116

    Description: epitope description:alpha-D-GalNAc-(1->2)-beta-D-Man-(1->4)-[beta-D-Glc-(1->2)]-alpha-D-Man-(1->5)-alpha-Kdo antigen name:lipopolysaccharide host orga...

  22. Identification of epitopes of the beta subunit of soybean beta-conglycinin that are antigenic in pigs, dogs, rabbits and fish.

    ID: 2110589

    Description: epitope description:ANIELVGIKEQQQKQK antigen name:Beta-conglycinin, beta chain host organism:Morone chrysops x Morone saxatilis

    Publication: 24415270;

  23. Identification of epitopes of the beta subunit of soybean beta-conglycinin that are antigenic in pigs, dogs, rabbits and fish.

    ID: 2110593

    Description: epitope description:PLEVQRYRAELSEDDV antigen name:Beta-conglycinin, beta chain host organism:Morone chrysops x Morone saxatilis

    Publication: 24415270;

  24. Identification of epitopes of the beta subunit of soybean beta-conglycinin that are antigenic in pigs, dogs, rabbits and fish.

    ID: 2110600

    Description: epitope description:LAFGINAENNQRNFLA antigen name:Beta-conglycinin, beta chain host organism:Morone chrysops x Morone saxatilis

    Publication: 24415270;

  25. Identification of epitopes of the beta subunit of soybean beta-conglycinin that are antigenic in pigs, dogs, rabbits and fish.

    ID: 2110606

    Description: epitope description:QELAFPGSAQDVERLL antigen name:Beta-conglycinin, beta chain host organism:Morone chrysops x Morone saxatilis

    Publication: 24415270;

  26. Identification of epitopes of the beta subunit of soybean beta-conglycinin that are antigenic in pigs, dogs, rabbits and fish.

    ID: 2110612

    Description: epitope description:QKEEGSKGRKGPFPSI antigen name:Beta-conglycinin, beta chain host organism:Morone chrysops x Morone saxatilis

    Publication: 24415270;

  27. Crystal structures of ricin toxin's enzymatic subunit (RTA) in complex with neutralizing and non-neutralizing single-chain antibodies.

    ID: 2110661

    Description: epitope description:Y126, H129, Q133, A136, E137, T140, H141, Q147, N148, R149, Y150, T151, F152, A153, F154, R160, L164, Y189, L196 antigen name:rRNA...

    Publication: 24907552;

  28. Crystal structures of ricin toxin's enzymatic subunit (RTA) in complex with neutralizing and non-neutralizing single-chain antibodies.

    ID: 2110669

    Description: epitope description:Y126, H129, Q133, A136, E137, T140, H141, Q147, N148, R149, Y150, T151, F152, A153, F154, R160, L164, Y189, L196 antigen name:rRNA...

    Publication: 24907552;

  29. Experimental Validation of Multi-Epitope Peptides Including Promising MHC Class I- and II-Restricted Epitopes of Four Known Leishmania infantum Protei...

    ID: 2110716

    Description: epitope description:GNIEGQWALKNHSLVSLSEQVLVSCDNIDD antigen name:Cysteine peptidase A (CPA) host organism:Mus musculus BALB/c

    Publication: 24959167;

  30. Experimental Validation of Multi-Epitope Peptides Including Promising MHC Class I- and II-Restricted Epitopes of Four Known Leishmania infantum Protei...

    ID: 2110718

    Description: epitope description:MSSDSAVAALSAAMTSPQKS antigen name:18 kDa nuclear protein host organism:Mus musculus BALB/c

    Publication: 24959167;

  31. Experimental Validation of Multi-Epitope Peptides Including Promising MHC Class I- and II-Restricted Epitopes of Four Known Leishmania infantum Protei...

    ID: 2110719

    Description: epitope description:AGAKKAGAKKAVRKVATPKK antigen name:18 kDa nuclear protein host organism:Mus musculus BALB/c

    Publication: 24959167;

  32. Experimental Validation of Multi-Epitope Peptides Including Promising MHC Class I- and II-Restricted Epitopes of Four Known Leishmania infantum Protei...

    ID: 2110720

    Description: epitope description:TYEEFSAKLDRLDEEFNRKM antigen name:Kinetoplastid membrane protein-11 host organism:Mus musculus BALB/c

    Publication: 24959167;

  33. Experimental Validation of Multi-Epitope Peptides Including Promising MHC Class I- and II-Restricted Epitopes of Four Known Leishmania infantum Protei...

    ID: 2110721

    Description: epitope description:KIAPQDQDSFLDDQPGVRPIPSFDDMPLHQ antigen name:Probable eukaryotic initiation factor 4A host organism:Mus musculus BALB/c

    Publication: 24959167;

  34. Identification and in vitro reactivity of celiac immunoactive peptides in an apparent gluten-free beer.

    ID: 2110817

    Description: epitope description:QPQLPY antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus antibody name:G12

    Publication: 24963630;

  35. Characterization of two antigenic sites recognized by neutralizing monoclonal antibodies directed against the fusion glycoprotein of human respiratory...

    ID: 2110841

    Description: epitope description:K272 antigen name:Fusion glycoprotein F0 host organism:Bos taurus antibody name:MAb B4

    Publication: 1383404;

  36. p-Tau immunotherapy reduces soluble and insoluble tau in aged 3xTg-AD mice.

    ID: 2110848

    Description: epitope description:EFRHDS antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:6E10

    Publication: 24887583;

  37. Characterization of immunological cross-reactivity between enterotoxigenic Escherichia coli heat-stable toxin and human guanylin and uroguanylin.

    ID: 2110868

    Description: epitope description:PGTCEICAYAACTGC antigen name:Guanylin host organism:Oryctolagus cuniculus antibody name:ab14344

    Publication: 24778111;

  38. Characterization of immunological cross-reactivity between enterotoxigenic Escherichia coli heat-stable toxin and human guanylin and uroguanylin.

    ID: 2110872

    Description: epitope description:NSSNYCCELCCNPACTGCY antigen name:Heat-stable enterotoxin A2 (STA2) host organism:Oryctolagus cuniculus

    Publication: 24778111;

  39. Characterization of immunological cross-reactivity between enterotoxigenic Escherichia coli heat-stable toxin and human guanylin and uroguanylin.

    ID: 2110878

    Description: epitope description:NDDCELCVNVACTGC antigen name:Guanylate cyclase activator 2B host organism:Oryctolagus cuniculus

    Publication: 24778111;

  40. Characterization of immunological cross-reactivity between enterotoxigenic Escherichia coli heat-stable toxin and human guanylin and uroguanylin.

    ID: 2110881

    Description: epitope description:NSSNYCCELCCNPACTGCF host organism:Mus musculus BALB/c antibody name:ST:G8

    Publication: 24778111;

  41. Characterization of immunological cross-reactivity between enterotoxigenic Escherichia coli heat-stable toxin and human guanylin and uroguanylin.

    ID: 2110884

    Description: epitope description:NTFYCCELCCNPACAGCY antigen name:Heat-stable enterotoxin ST-IA/ST-P host organism:Mus musculus BALB/c antibody name:ST:G8

    Publication: 24778111;

  42. Characterization of immunological cross-reactivity between enterotoxigenic Escherichia coli heat-stable toxin and human guanylin and uroguanylin.

    ID: 2110887

    Description: epitope description:NSSNYCCELCCNPACTGCY antigen name:Heat-stable enterotoxin A2 (STA2) host organism:Mus musculus BALB/c antibody name:ST:G8

    Publication: 24778111;

  43. Mechanism of action and epitopes of Clostridium difficile toxin B-neutralizing antibody bezlotoxumab revealed by X-ray crystallography.

    ID: 2110988

    Description: epitope description:E1878, Y1887, Q1890, S1900, T1901, E1902, D1903, F1905, D1939, N1941, R1943, G1944, V1946, E1947, P1960, E1961 antigen name:Toxin ...

    Publication: 24821719;

  44. Mechanism of action and epitopes of Clostridium difficile toxin B-neutralizing antibody bezlotoxumab revealed by X-ray crystallography.

    ID: 2110991

    Description: epitope description:Y2009, Y2018, E2021, N2031, T2032, E2033, D2034, G2035, F2036 antigen name:Toxin B host organism:Mus musculus HuMAb (Medarex) anti...

    Publication: 24821719;

  45. Mechanism of action and epitopes of Clostridium difficile toxin B-neutralizing antibody bezlotoxumab revealed by X-ray crystallography.

    ID: 2110997

    Description: epitope description:Y2009, Y2018, E2021, N2031, T2032, E2033, D2034, G2035, F2036 antigen name:Toxin B host organism:Mus musculus HuMAb (Medarex) anti...

    Publication: 24821719;

  46. Lower motor neuron syndrome associated with IgG anti-GM1 antibodies revisited.

    ID: 2111002

    Description: epitope description:ganglioside GM2 host organism:Homo sapiens

    Publication: 24841627;

  47. Lower motor neuron syndrome associated with IgG anti-GM1 antibodies revisited.

    ID: 2111003

    Description: epitope description:ganglioside X2 host organism:Homo sapiens

    Publication: 24841627;

  48. Effects of reduction in the alpha-gal antigen on bony union: a model of xenobone graft using GalT knockout mouse.

    ID: 2111014

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Mus musculus alpha-galactosyl transferase null

    Publication: 24635119;

  49. Effects of reduction in the alpha-gal antigen on bony union: a model of xenobone graft using GalT knockout mouse.

    ID: 2111015

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Mus musculus alpha-galactosyl transferase null

    Publication: 24635119;

  50. Non-stoichiometric O-acetylation of Shigella flexneri 2a O-specific polysaccharide: synthesis and antigenicity.

    ID: 2111076

    Description: epitope description:alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->3)-[alpha-D-Glcp-(1->4)]-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-L-Rhap3Ac-(1->2)-alp...

    Publication: 24836582;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston