Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109436

    Description: epitope description:LCYASQMQQTKPNPK antigen name:Polymerase cofactor VP35 host organism:Homo sapiens

    Publication: 24914933;

  2. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109442

    Description: epitope description:LEKVQRQIQVHAEQG antigen name:nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  3. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109444

    Description: epitope description:LESDDEEQDRDGTSN antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  4. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109446

    Description: epitope description:LFDLDEDDEDTKPVP antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  5. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109447

    Description: epitope description:LFEVDNLTYVQLESR antigen name:Super small secreted glycoprotein host organism:Homo sapiens

    Publication: 24914933;

  6. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109453

    Description: epitope description:LGVATAHGSTLAGVN antigen name:nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  7. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109590

    Description: epitope description:NTTTEDHKIMASENS antigen name:Envelope glycoprotein host organism:Homo sapiens

    Publication: 24914933;

  8. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109598

    Description: epitope description:PDISAKDLRNIMYDH antigen name:polymerase complex protein host organism:Homo sapiens

    Publication: 24914933;

  9. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109604

    Description: epitope description:PGFGTAFHQLVQVIC antigen name:Polymerase cofactor VP35 host organism:Homo sapiens

    Publication: 24914933;

  10. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109609

    Description: epitope description:PHRTIHHASAPLTDN antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  11. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109615

    Description: epitope description:PIFQDAAPPVIHIRS antigen name:polymerase complex protein host organism:Homo sapiens

    Publication: 24914933;

  12. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109622

    Description: epitope description:PKVLMKQIPIWLPLG antigen name:Matrix protein VP40 host organism:Homo sapiens

    Publication: 24914933;

  13. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109628

    Description: epitope description:PNLHYWTTQDEGAAI antigen name:spike glycoprotein host organism:Homo sapiens

    Publication: 24914933;

  14. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109638

    Description: epitope description:PQCALIQITKRVPIF antigen name:Polymerase cofactor VP35 host organism:Homo sapiens

    Publication: 24914933;

  15. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109640

    Description: epitope description:PQDEQQDQDHTQEAR antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  16. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109652

    Description: epitope description:PSGSTSPRMLTPINE antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  17. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109654

    Description: epitope description:PSLYEESAIRGKIES antigen name:Polymerase cofactor VP35 host organism:Homo sapiens

    Publication: 24914933;

  18. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109656

    Description: epitope description:PSSGYYSTTIRYQAT antigen name:Super small secreted glycoprotein host organism:Homo sapiens

    Publication: 24914933;

  19. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109666

    Description: epitope description:PVQLPQYFTFDLTAL antigen name:Matrix protein VP40 host organism:Homo sapiens

    Publication: 24914933;

  20. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109667

    Description: epitope description:PVYRDHSEKKELPQD antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  21. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109668

    Description: epitope description:PVYRDHSEKKELPQD antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  22. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109670

    Description: epitope description:PYFGPAAEGIYIEGL antigen name:Envelope glycoprotein host organism:Homo sapiens

    Publication: 24914933;

  23. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109672

    Description: epitope description:QATGFGTNETEYLFE antigen name:Super small secreted glycoprotein host organism:Homo sapiens

    Publication: 24914933;

  24. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109689

    Description: epitope description:QKKNEISFQQTNAMV antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  25. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109690

    Description: epitope description:QKKNEISFQQTNAMV antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  26. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109691

    Description: epitope description:QLQDGKTLGLKI antigen name:polymerase complex protein host organism:Homo sapiens

    Publication: 24914933;

  27. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109693

    Description: epitope description:QLQQYAESRELDHLG antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  28. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109695

    Description: epitope description:QLVQVICKLGKDSNS antigen name:Polymerase cofactor VP35 host organism:Homo sapiens

    Publication: 24914933;

  29. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109699

    Description: epitope description:QQDQDHTQEARNQDS antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  30. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109711

    Description: epitope description:QTKPNPKTRNSQTQT antigen name:Polymerase cofactor VP35 host organism:Homo sapiens

    Publication: 24914933;

  31. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113060

    Description: epitope description:GGSWGQPHGGGWG antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  32. Identification of human neutralizing antibodies against MERS-CoV and their role in virus adaptive evolution.

    ID: 2113066

    Description: epitope description:R542 antigen name:spike glycoprotein [Human betacoronavirus 2c EMC/2012] host organism:Homo sapiens antibody name:M14D3-Fc

    Publication: 24778221;

  33. Identification of human neutralizing antibodies against MERS-CoV and their role in virus adaptive evolution.

    ID: 2113069

    Description: epitope description:P547 antigen name:spike glycoprotein [Human betacoronavirus 2c EMC/2012] host organism:Homo sapiens antibody name:1E9-Fc

    Publication: 24778221;

  34. Identification of human neutralizing antibodies against MERS-CoV and their role in virus adaptive evolution.

    ID: 2113072

    Description: epitope description:L506, T512 antigen name:spike glycoprotein [Human betacoronavirus 2c EMC/2012] host organism:Homo sapiens antibody name:3B12-Fc

    Publication: 24778221;

  35. Identification of human neutralizing antibodies against MERS-CoV and their role in virus adaptive evolution.

    ID: 2113082

    Description: epitope description:L506, Y540 antigen name:spike glycoprotein [Human betacoronavirus 2c EMC/2012] host organism:Homo sapiens antibody name:3B11-Fc

    Publication: 24778221;

  36. Polyclonal and monoclonal antibodies specific for the six-helix bundle of the human respiratory syncytial virus fusion glycoprotein as probes of the p...

    ID: 2113091

    Description: epitope description:LEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIV antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zeala...

    Publication: 25010277;

  37. Polyclonal and monoclonal antibodies specific for the six-helix bundle of the human respiratory syncytial virus fusion glycoprotein as probes of the p...

    ID: 2113092

    Description: epitope description:DPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHHVNAGK antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zealand Whi...

    Publication: 25010277;

  38. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113118

    Description: epitope description:NLKHVAGAAAAGA antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  39. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113126

    Description: epitope description:AAAGAVVGGLGGY antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  40. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113158

    Description: epitope description:EDRYYRENMYRYP antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  41. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113163

    Description: epitope description:ENMYRYPNQVYYR antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  42. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113164

    Description: epitope description:ENMYRYPNQVYYR antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  43. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113166

    Description: epitope description:MYRYPNQVYYRPV antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  44. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113176

    Description: epitope description:RPVDQYSNQNNFV antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  45. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113179

    Description: epitope description:QYSNQNNFVHDCV antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  46. Polyclonal and monoclonal antibodies specific for the six-helix bundle of the human respiratory syncytial virus fusion glycoprotein as probes of the p...

    ID: 2113195

    Description: epitope description:S509, L513 antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zealand White antibody name:R145

    Publication: 25010277;

  47. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113198

    Description: epitope description:IKQHTVTTTTKGE antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  48. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113201

    Description: epitope description:TVTTTTKGENFTE antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  49. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113204

    Description: epitope description:TTTTKGENFTETD antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  50. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113209

    Description: epitope description:ENFTETDVKMMER antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston