Diagnostic value of a synthetic peptide derived from Echinococcus granulosus recombinant protein.

ID: 1465221

Description: epitope description:EAQKAKTKLEEVRLDLDSDKTKLKNAKTAEQKAK antigen name:Hydatid disease diagnostic antigen P-29 host organism:Homo sapiens

Peptide mimotopes displayed by phage inhibit antibody binding to bet v 1, the major birch pollen allergen, and induce specific IgG response in mice.

ID: 1465347

Description: epitope description:CFPYCYPSESA host organism:Mus musculus BALB/c antibody name:BIP1

Peptide mimotopes displayed by phage inhibit antibody binding to bet v 1, the major birch pollen allergen, and induce specific IgG response in mice.

ID: 1465380

Description: epitope description:CRQTRTMPGC host organism:Mus musculus BALB/c antibody name:BIP4

Localization of the continuous allergenic sites of ragweed allergen Ra3 by a comprehensive synthetic strategy.

ID: 1465447

Description: epitope description:RAYALWSARQQFKTT antigen name:Amb a 3 host organism:Mus musculus antibody name:anti-Ra3 (21-35)

Localization of the continuous allergenic sites of ragweed allergen Ra3 by a comprehensive synthetic strategy.

ID: 1465449

Description: epitope description:QFKTTDVLWFNFTTG antigen name:Amb a 3 host organism:Mus musculus antibody name:anti-Ra3 (31-45)

Induction of CD4+, human T lymphotropic virus type-1-specific cytotoxic T lymphocytes from patients with HAM/TSP. Recognition of an immunogenic region...

ID: 1465530

Description: epitope description:VSSYHSKPCNPAQPV antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

Identification of the amino acid residues in trichosanthin crucial for IgE response.

ID: 1465532

Description: epitope description:QQIGKR antigen name:Ribosome-inactivating protein alpha-trichosanthin host organism:Mus musculus antibody name:TE1

Induction of CD4+, human T lymphotropic virus type-1-specific cytotoxic T lymphocytes from patients with HAM/TSP. Recognition of an immunogenic region...

ID: 1465534

Description: epitope description:SSPYWKFQHDVNFTQEVSRLN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

Induction of CD4+, human T lymphotropic virus type-1-specific cytotoxic T lymphocytes from patients with HAM/TSP. Recognition of an immunogenic region...

ID: 1465546

Description: epitope description:LPFNWTHCFDPQ antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

ID: 1465616

Description: epitope description:LGGWKLQSDPRAYAL antigen name:Amb a 3 host organism:Mus musculus Outbred antibody name:anti-Ra3

Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

ID: 1465617

Description: epitope description:LGGWKLQSDPRAYAL antigen name:Amb a 3 host organism:Homo sapiens antibody name:human sera

Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

ID: 1465619

Description: epitope description:RAYALWSARQQFKTT antigen name:Amb a 3 host organism:Mus musculus Outbred antibody name:anti-Ra3

Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

ID: 1465621

Description: epitope description:QFKTTDVLWFNFTTG antigen name:Amb a 3 host organism:Mus musculus Outbred antibody name:anti-Ra3

Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

ID: 1465622

Description: epitope description:QFKTTDVLWFNFTTG antigen name:Amb a 3 host organism:Oryctolagus cuniculus antibody name:anti-Ra3

Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

ID: 1465634

Description: epitope description:PGGPDRFTLLTPGSH antigen name:Amb a 3 host organism:Homo sapiens antibody name:human sera

Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

ID: 1465635

Description: epitope description:PGGPDRFTLLTPGSH antigen name:Amb a 3 host organism:Oryctolagus cuniculus antibody name:anti-Ra3

Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

ID: 1465636

Description: epitope description:TPGSHFIATKDQKFV host organism:Oryctolagus cuniculus antibody name:anti-Ra3

Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

ID: 1465638

Description: epitope description:TPGSHFIATKDQKFV host organism:Mus musculus Outbred antibody name:anti-Ra3

Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

ID: 1465639

Description: epitope description:DQKFVAAVPGR host organism:Homo sapiens antibody name:human sera

Epitope mapping of envelope glycoprotein E1 of hog cholera virus strain Brescia.

ID: 1465642

Description: epitope description:SVTFELLFDGTSPLTEEMGDDFGFGLCPYDTSPVV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:b13