Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "
  1. Diagnostic value of a synthetic peptide derived from Echinococcus granulosus recombinant protein.

    ID: 1465221

    Description: epitope description:EAQKAKTKLEEVRLDLDSDKTKLKNAKTAEQKAK antigen name:Hydatid disease diagnostic antigen P-29 host organism:Homo sapiens

    Publication: 1737836;
  2. Peptide mimotopes displayed by phage inhibit antibody binding to bet v 1, the major birch pollen allergen, and induce specific IgG response in mice.

    ID: 1465347

    Description: epitope description:CFPYCYPSESA host organism:Mus musculus BALB/c antibody name:BIP1

    Publication: 9837853;
  3. Peptide mimotopes displayed by phage inhibit antibody binding to bet v 1, the major birch pollen allergen, and induce specific IgG response in mice.

    ID: 1465380

    Description: epitope description:CRQTRTMPGC host organism:Mus musculus BALB/c antibody name:BIP4

    Publication: 9837853;
  4. Localization of the continuous allergenic sites of ragweed allergen Ra3 by a comprehensive synthetic strategy.

    ID: 1465447

    Description: epitope description:RAYALWSARQQFKTT antigen name:Amb a 3 host organism:Mus musculus antibody name:anti-Ra3 (21-35)

    Publication: 2410296;
  5. Localization of the continuous allergenic sites of ragweed allergen Ra3 by a comprehensive synthetic strategy.

    ID: 1465449

    Description: epitope description:QFKTTDVLWFNFTTG antigen name:Amb a 3 host organism:Mus musculus antibody name:anti-Ra3 (31-45)

    Publication: 2410296;
  6. Induction of CD4+, human T lymphotropic virus type-1-specific cytotoxic T lymphocytes from patients with HAM/TSP. Recognition of an immunogenic region...

    ID: 1465530

    Description: epitope description:VSSYHSKPCNPAQPV antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1704032;
  7. Identification of the amino acid residues in trichosanthin crucial for IgE response.

    ID: 1465532

    Description: epitope description:QQIGKR antigen name:Ribosome-inactivating protein alpha-trichosanthin host organism:Mus musculus antibody name:TE1

    Publication: 12270124;
  8. Induction of CD4+, human T lymphotropic virus type-1-specific cytotoxic T lymphocytes from patients with HAM/TSP. Recognition of an immunogenic region...

    ID: 1465534

    Description: epitope description:SSPYWKFQHDVNFTQEVSRLN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1704032;
  9. Induction of CD4+, human T lymphotropic virus type-1-specific cytotoxic T lymphocytes from patients with HAM/TSP. Recognition of an immunogenic region...

    ID: 1465546

    Description: epitope description:LPFNWTHCFDPQ antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1704032;
  10. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465616

    Description: epitope description:LGGWKLQSDPRAYAL antigen name:Amb a 3 host organism:Mus musculus Outbred antibody name:anti-Ra3

    Publication: 2420608;
  11. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465617

    Description: epitope description:LGGWKLQSDPRAYAL antigen name:Amb a 3 host organism:Homo sapiens antibody name:human sera

    Publication: 2420608;
  12. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465619

    Description: epitope description:RAYALWSARQQFKTT antigen name:Amb a 3 host organism:Mus musculus Outbred antibody name:anti-Ra3

    Publication: 2420608;
  13. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465621

    Description: epitope description:QFKTTDVLWFNFTTG antigen name:Amb a 3 host organism:Mus musculus Outbred antibody name:anti-Ra3

    Publication: 2420608;
  14. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465622

    Description: epitope description:QFKTTDVLWFNFTTG antigen name:Amb a 3 host organism:Oryctolagus cuniculus antibody name:anti-Ra3

    Publication: 2420608;
  15. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465634

    Description: epitope description:PGGPDRFTLLTPGSH antigen name:Amb a 3 host organism:Homo sapiens antibody name:human sera

    Publication: 2420608;
  16. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465635

    Description: epitope description:PGGPDRFTLLTPGSH antigen name:Amb a 3 host organism:Oryctolagus cuniculus antibody name:anti-Ra3

    Publication: 2420608;
  17. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465636

    Description: epitope description:TPGSHFIATKDQKFV host organism:Oryctolagus cuniculus antibody name:anti-Ra3

    Publication: 2420608;
  18. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465638

    Description: epitope description:TPGSHFIATKDQKFV host organism:Mus musculus Outbred antibody name:anti-Ra3

    Publication: 2420608;
  19. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465639

    Description: epitope description:DQKFVAAVPGR host organism:Homo sapiens antibody name:human sera

    Publication: 2420608;
  20. Epitope mapping of envelope glycoprotein E1 of hog cholera virus strain Brescia.

    ID: 1465642

    Description: epitope description:SVTFELLFDGTSPLTEEMGDDFGFGLCPYDTSPVV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:b13

    Publication: 7691986;

Displaying 20 of 1,510,353 results for " "