Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Identifying epitopes responsible for neutralizing antibody and DC-SIGN binding on the spike glycoprotein of the severe acute respiratory syndrome coro...

    ID: 1368899

    Description: epitope description:NYNWKR host organism:Mus musculus BALB/c antibody name:SIb4

    Publication: 17041212;

  2. Mutation analysis of the fusion domain region of St. Louis encephalitis virus envelope protein.

    ID: 1368906

    Description: epitope description:G106 antigen name:polyprotein host organism:Mus musculus antibody name:6B4A-10

    Publication: 17157348;

  3. Mutation analysis of the fusion domain region of St. Louis encephalitis virus envelope protein.

    ID: 1368908

    Description: epitope description:G106, L107 antigen name:polyprotein host organism:Mus musculus antibody name:1B2C-5

    Publication: 17157348;

  4. A study on antigenicity and receptor-binding ability of fragment 450-650 of the spike protein of SARS coronavirus.

    ID: 1368910

    Description: epitope description:CGPKLSTDLIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQFGRDVSDFTD antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 17055551;

  5. Identifying epitopes responsible for neutralizing antibody and DC-SIGN binding on the spike glycoprotein of the severe acute respiratory syndrome coro...

    ID: 1368911

    Description: epitope description:NYNWKR host organism:Mus musculus BALB/c antibody name:SIb4

    Publication: 17041212;

  6. A study on antigenicity and receptor-binding ability of fragment 450-650 of the spike protein of SARS coronavirus.

    ID: 1368924

    Description: epitope description:VNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDI antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 17055551;

  7. A single 10-residue pre-S(1) peptide can prime T cell help for antibody production to multiple epitopes within the pre-S(1), pre-S(2), and S regions o...

    ID: 1368942

    Description: epitope description:LGFFPDHQLDP antigen name:Large envelope protein host organism:Mus musculus SJL

    Publication: 2438344;

  8. Mimicry of native peptide antigens by the corresponding retro-inverso analogs is dependent on their intrinsic structure and interaction propensities.

    ID: 1369141

    Description: epitope description:GFAPDLQ + AMID(G1) host organism:Mus musculus antibody name:282, 283, 287

    Publication: 12538696;

  9. Mimicry of native peptide antigens by the corresponding retro-inverso analogs is dependent on their intrinsic structure and interaction propensities.

    ID: 1369142

    Description: epitope description:QLDPAFG antigen name:Large envelope protein host organism:Mus musculus antibody name:282, 283, 287

    Publication: 12538696;

  10. Human monoclonal antibody combination against SARS coronavirus: synergy and coverage of escape mutants.

    ID: 1369150

    Description: epitope description:P462 antigen name:Spike glycoprotein host organism:Homo sapiens antibody name:CR3014

    Publication: 16796401;

  11. Mapping of immunodominant B-cell epitopes and the human serum albumin-binding site in natural hepatitis B virus surface antigen of defined genosubtype...

    ID: 1369174

    Description: epitope description:MQWNST + GLYC(N4) antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:1-8H1

    Publication: 10644835;

  12. Mapping of immunodominant B-cell epitopes and the human serum albumin-binding site in natural hepatitis B virus surface antigen of defined genosubtype...

    ID: 1369256

    Description: epitope description:TVSPISSIFSR antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:1-9D1

    Publication: 10644835;

  13. Mapping of immunodominant B-cell epitopes and the human serum albumin-binding site in natural hepatitis B virus surface antigen of defined genosubtype...

    ID: 1369264

    Description: epitope description:VRGLYFP antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:2-12F2

    Publication: 10644835;

  14. Identification of neutralizing linear epitopes from the VP1 capsid protein of Enterovirus 71 using synthetic peptides.

    ID: 1369322

    Description: epitope description:PESRESLAWQTATNP antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 17222936;

  15. Identification of neutralizing linear epitopes from the VP1 capsid protein of Enterovirus 71 using synthetic peptides.

    ID: 1369328

    Description: epitope description:YPTFGEHKQEKDLEY antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 17222936;

  16. Identification of neutralizing linear epitopes from the VP1 capsid protein of Enterovirus 71 using synthetic peptides.

    ID: 1369338

    Description: epitope description:YPTFGEHKQEKDLEY antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 17222936;

  17. Antigenic and cellular localisation analysis of the severe acute respiratory syndrome coronavirus nucleocapsid protein using monoclonal antibodies.

    ID: 1369345

    Description: epitope description:A274, F275, G276, R277, R278, G279, P280, E281, Q282, T283, K373, K374, K375, K376, T377, D378, E379, A380, Q381, P382 antigen nam...

    Publication: 16920216;

  18. Selection of SARS-coronavirus-specific B cell epitopes by phage peptide library screening and evaluation of the immunological effect of epitope-based ...

    ID: 1369347

    Description: epitope description:NLPSTETRHVTR host organism:Homo sapiens

    Publication: 17055022;

  19. Antigenicity of amino-acid sequences from Clostridium difficile toxin B.

    ID: 1369354

    Description: epitope description:SGIIESGVQNIDDNYFY antigen name:Toxin B host organism:Mus musculus Swiss Webster

    Publication: 8636964;

  20. Antigenicity of amino-acid sequences from Clostridium difficile toxin B.

    ID: 1369355

    Description: epitope description:GIVQIGVFDTSDGYKYFAPANTVND antigen name:Toxin B host organism:Mus musculus Swiss Webster

    Publication: 8636964;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston