Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361378

    Description: epitope description:TQGMHEIAESLRAV antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  2. Fine mapping of virus-neutralizing epitopes on hepatitis B virus PreS1.

    ID: 1356928

    Description: epitope description:NTANPDWDF antigen name:Large envelope protein host organism:Mus musculus antibody name:KR359

    Publication: 10772975;

  3. Immunogenicity of viral B-cell epitopes inserted into two surface loops of the Escherichia coli K12 LamB protein and expressed in an attenuated aroA s...

    ID: 1356944

    Description: epitope description:DNPASTTNKDK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 10078601;

  4. HBV infection of cell culture: evidence for multivalent and cooperative attachment.

    ID: 1357015

    Description: epitope description:DPAF antigen name:Large envelope protein host organism:Mus musculus antibody name:mAb 18/7

    Publication: 11500372;

  5. Comparative antigenicity and immunogenicity of hepadnavirus core proteins.

    ID: 1357114

    Description: epitope description:NANPNANPNANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus

    Publication: 16227284;

  6. Effect of variation in the common ""a"" determinant on the antigenicity of hepatitis B surface antigen.

    ID: 1357332

    Description: epitope description:P142, G145 antigen name:Large envelope protein host organism:Cavia porcellus antibody name:AUSRIA kit antibody

    Publication: 10596008;

  7. Effect of variation in the common ""a"" determinant on the antigenicity of hepatitis B surface antigen.

    ID: 1357333

    Description: epitope description:G145 antigen name:Large envelope protein host organism:Mus musculus antibody name:RFHBs 1, 7, 18

    Publication: 10596008;

  8. Characterization of complex B cell epitopes on woodchuck hepatitis virus surface antigens by using plasmids encoding chimeric proteins and DNA immuniz...

    ID: 1357357

    Description: epitope description:CRQCTISYQDMYTPPYCCCLKPTAGNC antigen name:Large envelope protein host organism:Capra hircus

    Publication: 12009876;

  9. Characterization of complex B cell epitopes on woodchuck hepatitis virus surface antigens by using plasmids encoding chimeric proteins and DNA immuniz...

    ID: 1357392

    Description: epitope description:TLSPAVPTVSTILS antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 12009876;

  10. Characterization of complex B cell epitopes on woodchuck hepatitis virus surface antigens by using plasmids encoding chimeric proteins and DNA immuniz...

    ID: 1357412

    Description: epitope description:MKNQTFHLQGFVDGL antigen name:Large envelope protein host organism:Mus musculus antibody name:WHs2.1

    Publication: 12009876;

  11. Hepatitis delta antigen. Antigenic structure and humoral immune response.

    ID: 1357491

    Description: epitope description:GEGAPPAKRARTDQME antigen name:Small delta antigen host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2479687;

  12. Hepatitis delta antigen. Antigenic structure and humoral immune response.

    ID: 1357504

    Description: epitope description:SRGAPGGGFVPSLQGVP antigen name:Small delta antigen host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2479687;

  13. Expression and immunoactivity of chimeric particulate antigens of receptor binding site-core antigen of hepatitis B virus.

    ID: 1360221

    Description: epitope description:PLGFFPDHQLDPAFGANSNNPDWDFNP antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 15641132;

  14. Hepatitis delta antigen. Antigenic structure and humoral immune response.

    ID: 1360250

    Description: epitope description:GEGAPPAKRARTDQME antigen name:Small delta antigen host organism:Homo sapiens

    Publication: 2479687;

  15. Hepatitis delta antigen. Antigenic structure and humoral immune response.

    ID: 1360268

    Description: epitope description:TDQMEVDSGPRKRPLRGG antigen name:Small delta antigen host organism:Marmota monax

    Publication: 2479687;

  16. Hypervariable region IV of Salmonella gene fliCd encodes a dominant surface epitope and a stabilizing factor for functional flagella.

    ID: 1360293

    Description: epitope description:MGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNS antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 7512552;

  17. Hepatitis B virus e antigen specific epitopes and limitations of commercial anti-HBe immunoassays.

    ID: 1360338

    Description: epitope description:YVNTNMGLKIRQ antigen name:Capsid protein host organism:Oryctolagus cuniculus

    Publication: 10630956;

  18. Hepatitis B virus e antigen specific epitopes and limitations of commercial anti-HBe immunoassays.

    ID: 1360343

    Description: epitope description:CSPHHTALRQ antigen name:Capsid protein host organism:Oryctolagus cuniculus

    Publication: 10630956;

  19. Fine mapping of neutralization epitopes on duck hepatitis B virus (DHBV) pre-S protein using monoclonal antibodies and overlapping peptides.

    ID: 1360709

    Description: epitope description:NPTPQEIPQPQWTPEEDQKAREAF antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:24A4, 15B2

    Publication: 7685963;

  20. Anti-HBs after hepatitis B immunization with plasma-derived and recombinant DNA-derived vaccines: binding to mutant HBsAg.

    ID: 1360831

    Description: epitope description:STTTSTGPCKTCTTPAQGNSMFPSC antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 11395201;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston