Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Fine mapping of neutralization epitopes on duck hepatitis B virus (DHBV) pre-S protein using monoclonal antibodies and overlapping peptides.

    ID: 1360833

    Description: epitope description:NPTPQEIPQPQWTPEEDQKAREAF antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:24A4, 15B2, 5

    Publication: 7685963;

  2. Fine mapping of neutralization epitopes on duck hepatitis B virus (DHBV) pre-S protein using monoclonal antibodies and overlapping peptides.

    ID: 1360866

    Description: epitope description:FRRYQEER antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:SD20

    Publication: 7685963;

  3. Fine mapping of neutralization epitopes on duck hepatitis B virus (DHBV) pre-S protein using monoclonal antibodies and overlapping peptides.

    ID: 1360871

    Description: epitope description:IPQPQWTP antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:900

    Publication: 7685963;

  4. Anti-HBs after hepatitis B immunization with plasma-derived and recombinant DNA-derived vaccines: binding to mutant HBsAg.

    ID: 1360876

    Description: epitope description:PAQGNSMFPSCCCTKPTDANCTCIP host organism:Homo sapiens

    Publication: 11395201;

  5. Anti-HBs after hepatitis B immunization with plasma-derived and recombinant DNA-derived vaccines: binding to mutant HBsAg.

    ID: 1360889

    Description: epitope description:FPSCCCTKPTDKNCTCIPIPSSWAF host organism:Homo sapiens

    Publication: 11395201;

  6. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361382

    Description: epitope description:AESLRAVIPPTTTP antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  7. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361384

    Description: epitope description:IPPTTTPVPPGYLI antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  8. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361388

    Description: epitope description:VPPGYLIQHEEAEE antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  9. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361400

    Description: epitope description:VSFQPDYPITARIH antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  10. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361403

    Description: epitope description:PITARIHAHLKAYA antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  11. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361405

    Description: epitope description:AHLKAYAKINEESL antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  12. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361420

    Description: epitope description:TNYISRLRTWLSTP antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  13. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361431

    Description: epitope description:APTIEAITRPIQVA antigen name:Capsid protein host organism:Anas platyrhynchos

    Publication: 14747559;

  14. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361452

    Description: epitope description:SRERRAPTPQRAGS antigen name:External core antigen host organism:Anas platyrhynchos

    Publication: 14747559;

  15. Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

    ID: 1361455

    Description: epitope description:TPQRAGSPLPRSSS antigen name:External core antigen host organism:Anas platyrhynchos

    Publication: 14747559;

  16. Significance of pre-S region-defective hepatitis B virus that emerged during exacerbation of chronic type B hepatitis.

    ID: 1361476

    Description: epitope description:PLGFFPDHQLDPAFGANSNNPDWDFN antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 8477960;

  17. Significance of pre-S region-defective hepatitis B virus that emerged during exacerbation of chronic type B hepatitis.

    ID: 1361477

    Description: epitope description:ASTNRQSGRQPTPISPPLRDSHPQ antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 8477960;

  18. Maltodextrin-binding protein hybrids carrying epitopes from the preS2 region of hepatitis B virus: expression, antibody-binding and preliminary crysta...

    ID: 1361485

    Description: epitope description:QDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Mus musculus antibody name:mAb S2.3

    Publication: 9089817;

  19. Fine and domain-level epitope mapping of botulinum neurotoxin type A neutralizing antibodies by yeast surface display.

    ID: 1368116

    Description: epitope description:Q1254, F1255, N1256 antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:S25

    Publication: 17059824;

  20. 48-mer synthetic peptide analogue of the hepatitis B virus ""a"" determinant induces an anti-HBs antibody response after a single injection.

    ID: 1368135

    Description: epitope description:CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWAS antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 11002244;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston