Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. 48-mer synthetic peptide analogue of the hepatitis B virus ""a"" determinant induces an anti-HBs antibody response after a single injection.

    ID: 1368142

    Description: epitope description:CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWAS antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 11002244;

  2. 48-mer synthetic peptide analogue of the hepatitis B virus ""a"" determinant induces an anti-HBs antibody response after a single injection.

    ID: 1368150

    Description: epitope description:CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWAS antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 11002244;

  3. Identification of hepatitis A virus mimotopes by phage display, antigenicity and immunogenicity.

    ID: 1368151

    Description: epitope description:SHSAFNMFDFGVGPP host organism:Homo sapiens antibody name:anti-HAV

    Publication: 17129616;

  4. Identification of hepatitis A virus mimotopes by phage display, antigenicity and immunogenicity.

    ID: 1368152

    Description: epitope description:SHSVTKSLRVFGGPP host organism:Homo sapiens antibody name:anti-HAV

    Publication: 17129616;

  5. 48-mer synthetic peptide analogue of the hepatitis B virus ""a"" determinant induces an anti-HBs antibody response after a single injection.

    ID: 1368161

    Description: epitope description:CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWAS antigen name:Large envelope protein host organism:Cavia porcellus Duncan-Hartley

    Publication: 11002244;

  6. 48-mer synthetic peptide analogue of the hepatitis B virus ""a"" determinant induces an anti-HBs antibody response after a single injection.

    ID: 1368162

    Description: epitope description:CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWAS antigen name:Large envelope protein host organism:Cavia porcellus Duncan-Hartley

    Publication: 11002244;

  7. Identification of hepatitis A virus mimotopes by phage display, antigenicity and immunogenicity.

    ID: 1368180

    Description: epitope description:SHSQLGPPVGGPP host organism:Mus musculus BALB/c antibody name:anti-HAV

    Publication: 17129616;

  8. Characterization of an immunodominant antigenic site on GB virus C glycoprotein E2 that is involved in cell binding.

    ID: 1368221

    Description: epitope description:FYEPLVRRC antigen name:Pegivirus C protein host organism:Mus musculus antibody name:M6

    Publication: 17035329;

  9. Characterization of an immunodominant antigenic site on GB virus C glycoprotein E2 that is involved in cell binding.

    ID: 1368225

    Description: epitope description:FYEPLVRRC antigen name:Pegivirus C protein host organism:Mus musculus antibody name:M6

    Publication: 17035329;

  10. A single 10-residue pre-S(1) peptide can prime T cell help for antibody production to multiple epitopes within the pre-S(1), pre-S(2), and S regions o...

    ID: 1368332

    Description: epitope description:PAANQVGVGAFGPRLTPPHGG antigen name:Large envelope protein host organism:Mus musculus

    Publication: 2438344;

  11. A single 10-residue pre-S(1) peptide can prime T cell help for antibody production to multiple epitopes within the pre-S(1), pre-S(2), and S regions o...

    ID: 1368337

    Description: epitope description:PAFRANTANPDWDFNPNKDTWP antigen name:Large envelope protein host organism:Mus musculus

    Publication: 2438344;

  12. Newly characterized species-specific immunogenic Chlamydophila pneumoniae peptide reactive with murine monoclonal and human serum antibodies.

    ID: 1368349

    Description: epitope description:PNEPDDALAMRIIRI host organism:Mus musculus BALB/c antibody name:8A6

    Publication: 11874892;

  13. Newly characterized species-specific immunogenic Chlamydophila pneumoniae peptide reactive with murine monoclonal and human serum antibodies.

    ID: 1368362

    Description: epitope description:LRNCEQDFFTLN host organism:Homo sapiens antibody name:normal human sera

    Publication: 11874892;

  14. Newly characterized species-specific immunogenic Chlamydophila pneumoniae peptide reactive with murine monoclonal and human serum antibodies.

    ID: 1368364

    Description: epitope description:PNEPDDALAMRIIRI host organism:Homo sapiens antibody name:normal human sera

    Publication: 11874892;

  15. Quadruple antigenic epitope peptide producing immune protection against classical swine fever virus.

    ID: 1368381

    Description: epitope description:TAVSPTTLRTEVVK antigen name:Genome polyprotein host organism:Sus scrofa

    Publication: 17050046;

  16. Influences of glycosylation on antigenicity, immunogenicity, and protective efficacy of ebola virus GP DNA vaccines.

    ID: 1368399

    Description: epitope description:QVEQHHRRTDNDSTASDT antigen name:Envelope glycoprotein host organism:Mus musculus BALB/c

    Publication: 17151111;

  17. Influences of glycosylation on antigenicity, immunogenicity, and protective efficacy of ebola virus GP DNA vaccines.

    ID: 1368403

    Description: epitope description:AGPPKAENTNTSKSTDFL antigen name:Envelope glycoprotein host organism:Mus musculus BALB/c

    Publication: 17151111;

  18. Influences of glycosylation on antigenicity, immunogenicity, and protective efficacy of ebola virus GP DNA vaccines.

    ID: 1368408

    Description: epitope description:GLICGLRQLANETTQALQ antigen name:Envelope glycoprotein host organism:Mus musculus BALB/c

    Publication: 17151111;

  19. Influences of glycosylation on antigenicity, immunogenicity, and protective efficacy of ebola virus GP DNA vaccines.

    ID: 1368409

    Description: epitope description:RQLANETTQALQLFLRAT antigen name:Envelope glycoprotein host organism:Mus musculus BALB/c

    Publication: 17151111;

  20. Influences of glycosylation on antigenicity, immunogenicity, and protective efficacy of ebola virus GP DNA vaccines.

    ID: 1368417

    Description: epitope description:VDKTLPDQGDNDNWWTGW antigen name:Envelope glycoprotein host organism:Mus musculus BALB/c

    Publication: 17151111;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston