Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1542360

    Description: epitope description:GTDSGWGNRQSF antigen name:Major outer membrane protein P.IB host organism:Mus musculus BALB/c antibody name:MN15A14H6; 2-2-P15; 18...

    Publication: 7551027;

  2. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1542361

    Description: epitope description:FGKLRVGRLNSV antigen name:Major outer membrane protein P.IB host organism:Mus musculus BALB/c antibody name:MN15A14H6; 2-2-P15; 18...

    Publication: 7551027;

  3. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1542364

    Description: epitope description:PEFAGLSGSVQY antigen name:Major outer membrane protein P.IB host organism:Mus musculus BALB/c antibody name:MN15A14H6; 2-2-P15; 18...

    Publication: 7551027;

  4. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1542365

    Description: epitope description:GRHNSESYHAGF antigen name:Major outer membrane protein P.IB host organism:Mus musculus BALB/c antibody name:MN15A14H6; 2-2-P15; 18...

    Publication: 7551027;

  5. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1542367

    Description: epitope description:FFVQYGGAYKRH antigen name:Major outer membrane protein P.IB host organism:Mus musculus BALB/c antibody name:MN15A14H6; 2-2-P15; 18...

    Publication: 7551027;

  6. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1542369

    Description: epitope description:LNIEKYQIHRLV antigen name:Major outer membrane protein P.IB host organism:Mus musculus BALB/c antibody name:MN15A14H6

    Publication: 7551027;

  7. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542437

    Description: epitope description:LLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  8. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542439

    Description: epitope description:SKLLTLVQLTLQSTNYTCIVCID antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  9. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542445

    Description: epitope description:LALPAPHLTLPFNWTHCFDPQIQ antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  10. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542465

    Description: epitope description:GDYSPSCCTLTIGVSSYHSKP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  11. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542466

    Description: epitope description:SYHSKPCNPAQPVCSWTLDLLAL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  12. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542470

    Description: epitope description:TKKPNRNGGGYYSASYSDPCSL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  13. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542471

    Description: epitope description:SYSDPCSLKCPYLGCQSWTCPYT antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  14. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542472

    Description: epitope description:PCSLKCPYLGCQSWTCPYTGAVS antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  15. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542491

    Description: epitope description:NSLILPPFSLSPVPTLGSRSRRA antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  16. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542492

    Description: epitope description:RSRRAVPVAVWLVSALAMGAGVA antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  17. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542494

    Description: epitope description:SLLHEVDKDISQLTQAIVKNHKN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  18. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542497

    Description: epitope description:KNHKNLLKIAQYAAQNRRGLDLL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  19. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542499

    Description: epitope description:GLDLLFWEQGGLCKALQEQCRFPN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  20. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542504

    Description: epitope description:SQWAREALQTGITLVALLLLVIL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  21. Investigation of synthetic Escherichia coli heat-stable enterotoxin as an immunogen for swine and cattle.

    ID: 1542520

    Description: epitope description:CCELCCNPACAGCY antigen name:Heat-stable enterotoxin ST-IA/ST-P host organism:Bos taurus

    Publication: 3552985;

  22. Investigation of synthetic Escherichia coli heat-stable enterotoxin as an immunogen for swine and cattle.

    ID: 1542541

    Description: epitope description:NTFYCCELCCNPACAGCY antigen name:Heat-stable enterotoxin ST-IA/ST-P host organism:Sus scrofa

    Publication: 3552985;

  23. Neutralizing antibodies to human rhinovirus produced in laboratory animals and humans that recognize a linear sequence from VP2.

    ID: 1542570

    Description: epitope description:TRLNPD antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:8F5

    Publication: 1703215;

  24. Neutralizing antibodies to human rhinovirus produced in laboratory animals and humans that recognize a linear sequence from VP2.

    ID: 1548521

    Description: epitope description:VKAETRLNPDLQPTE antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1703215;

  25. Analysis of T and B cell epitopes of the Schistosoma mansoni P28 antigen in the rat model by using synthetic peptides.

    ID: 1548522

    Description: epitope description:LVAAGVDYEDERISFQDWPK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Rattus norvegicus Fischer 344

    Publication: 2457624;

  26. Neutralizing antibodies to human rhinovirus produced in laboratory animals and humans that recognize a linear sequence from VP2.

    ID: 1548523

    Description: epitope description:VKAETRLNPDLQPTE antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1703215;

  27. Neutralizing antibodies to human rhinovirus produced in laboratory animals and humans that recognize a linear sequence from VP2.

    ID: 1548529

    Description: epitope description:VKAETRLNPDLQPTE antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1703215;

  28. Neutralizing antibodies to human rhinovirus produced in laboratory animals and humans that recognize a linear sequence from VP2.

    ID: 1548533

    Description: epitope description:VKAETRLNPDLQPTE antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 1703215;

  29. Analysis of T and B cell epitopes of the Schistosoma mansoni P28 antigen in the rat model by using synthetic peptides.

    ID: 1548544

    Description: epitope description:VDYEDERISFQDWPKIKPTIPGGRL antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Rattus norvegicus Fischer 3...

    Publication: 2457624;

  30. Identification of residues in VP2 that contribute to poliovirus neutralization antigenic site 3B.

    ID: 1548555

    Description: epitope description:T141, E143, S312, E315, P417 antigen name:Genome polyprotein host organism:Mus musculus antibody name:10, 13, 15

    Publication: 1714663;

  31. Kinetics of antigen-antibody interactions employing a MALDI mass spectrometry immunoassay.

    ID: 1548560

    Description: epitope description:AYSNCYPYDVPDYASLR + METH(C5) antigen name:Hemagglutinin host organism:Mus musculus SJL antibody name:12/5

    Publication: 18816071;

  32. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548564

    Description: epitope description:AGEVRIGEINNGIQVGAKYDANDIVA antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus

    Publication: 8500904;

  33. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548565

    Description: epitope description:DIVAKIAYGRTNYKYNESDEHKQQLNG antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus

    Publication: 8500904;

  34. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548566

    Description: epitope description:DIVAKIAYGRTNYKYNESDEHKQQLNG antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus

    Publication: 8500904;

  35. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548569

    Description: epitope description:YELMEDTNVYGNFKYERTSVDQGEKTR antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus

    Publication: 8500904;

  36. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548576

    Description: epitope description:ARTRTTETGKGVKTEKEKSVGVGLRVYF antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus

    Publication: 8500904;

  37. Defining antibody targets in Streptococcus oralis infection.

    ID: 1548584

    Description: epitope description:SWYGAG antigen name:Cell wall surface anchor family protein host organism:Homo sapiens

    Publication: 8613367;

  38. Defining antibody targets in Streptococcus oralis infection.

    ID: 1548585

    Description: epitope description:GKIRAV antigen name:Cell wall surface anchor family protein host organism:Homo sapiens

    Publication: 8613367;

  39. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548593

    Description: epitope description:GANYLLAQKREGAKGENKRPNDKAGEV antigen name:Outer membrane protein P2 host organism:Mus musculus C57BL/6 antibody name:anti-P2

    Publication: 8500904;

  40. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548594

    Description: epitope description:DIVAKIAYGRTNYKYNESDEHKQQLNG antigen name:Outer membrane protein P2 host organism:Mus musculus C57BL/6 antibody name:anti-P2

    Publication: 8500904;

  41. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548602

    Description: epitope description:VDNQKQQHGALRNQGSRFHIKATHNFGD antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:anti-P2

    Publication: 8500904;

  42. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548603

    Description: epitope description:FGDITSKYAYVTLGNKAFGEVKLGRAKT antigen name:Outer membrane protein P2 host organism:Mus musculus C3H antibody name:anti-P2

    Publication: 8500904;

  43. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548606

    Description: epitope description:GRAKTIADGITSAEDKEYGVLNNSDYIP antigen name:Outer membrane protein P2 host organism:Mus musculus C57BL/6 antibody name:anti-P2

    Publication: 8500904;

  44. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548608

    Description: epitope description:SDYIPTSGNTVGYTFKGIDGLVLGAN antigen name:Outer membrane protein P2 host organism:Mus musculus C57BL/6 antibody name:anti-P2

    Publication: 8500904;

  45. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548609

    Description: epitope description:AGEVRIGEINNGIQVGAKYDANDIVA antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:anti-P2

    Publication: 8500904;

  46. Identification of linear B-cell determinants of pertussis toxin associated with the receptor recognition site of the S3 subunit.

    ID: 1548741

    Description: epitope description:TQQGGAYGRCPNGTRA antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus Chinchilla Bastard

    Publication: 1706321;

  47. Identification of linear B-cell determinants of pertussis toxin associated with the receptor recognition site of the S3 subunit.

    ID: 1548756

    Description: epitope description:GQPAADHYYSKVT antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus Chinchilla Bastard

    Publication: 1706321;

  48. Immunological detection of penicillin-binding protein 2' of methicillin-resistant staphylococci by using monoclonal antibodies prepared from synthetic...

    ID: 1548765

    Description: epitope description:YNKLTEDKKEPLLNKFQITTSPGSTQKILTA antigen name:UniProt:A7WWU8 host organism:Mus musculus BALB/c

    Publication: 7494059;

  49. Immunological detection of penicillin-binding protein 2' of methicillin-resistant staphylococci by using monoclonal antibodies prepared from synthetic...

    ID: 1548766

    Description: epitope description:IGLNNKTLDDKTSYKIDGKGWQKDKSWGGY antigen name:UniProt:A7WWU8 host organism:Mus musculus BALB/c

    Publication: 7494059;

  50. Epitope-specific protective immunogenicity of chemically synthesized 13-, 18-, and 23-residue peptide fragments of streptococcal M protein.

    ID: 1548767

    Description: epitope description:RKADLEKALEGAM antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6425829;

  51. Epitope-specific protective immunogenicity of chemically synthesized 13-, 18-, and 23-residue peptide fragments of streptococcal M protein.

    ID: 1548768

    Description: epitope description:RKADLEKALEGAM antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6425829;

  52. Epitope-specific protective immunogenicity of chemically synthesized 13-, 18-, and 23-residue peptide fragments of streptococcal M protein.

    ID: 1548774

    Description: epitope description:RKADLEKALEGAM antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6425829;

  53. Epitope-specific protective immunogenicity of chemically synthesized 13-, 18-, and 23-residue peptide fragments of streptococcal M protein.

    ID: 1548778

    Description: epitope description:LEAEKAALAARKADLEKALEGAM antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6425829;

  54. Improved mimicry of a foot-and-mouth disease virus antigenic site by a viral peptide displayed on beta-galactosidase surface.

    ID: 1548789

    Description: epitope description:YTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus antibody name:SB10, SD6

    Publication: 9634810;

  55. Improved mimicry of a foot-and-mouth disease virus antigenic site by a viral peptide displayed on beta-galactosidase surface.

    ID: 1548791

    Description: epitope description:YTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus antibody name:7FC12, 7CA8, 7JD1

    Publication: 9634810;

  56. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548807

    Description: epitope description:VDNQKQQHGALRNQGSRFHIKATHNFGD antigen name:Outer membrane protein P2 host organism:Cavia porcellus antibody name:anti-P2

    Publication: 8500904;

  57. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548814

    Description: epitope description:DIVAKIAYGRTNYKYNESDEHKQQLNG antigen name:Outer membrane protein P2 host organism:Cavia porcellus antibody name:anti-P2

    Publication: 8500904;

  58. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548827

    Description: epitope description:LSIIAEQSNSTVDNQK antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus antibody name:anti-P2

    Publication: 8500904;

  59. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548840

    Description: epitope description:FGDITSKYAYVTLGNKAFGEVKLGRAKT antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus antibody name:anti-P2

    Publication: 8500904;

  60. Different B-cell responses to human T-cell lymphotropic virus type I (HTLV-I) envelope synthetic peptides in HTLV-I-infected individuals.

    ID: 1548844

    Description: epitope description:DISQLTQAIVKNHKNLLK antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1890164;

  61. Different B-cell responses to human T-cell lymphotropic virus type I (HTLV-I) envelope synthetic peptides in HTLV-I-infected individuals.

    ID: 1548848

    Description: epitope description:EQGGLCKALQEQCRF antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1890164;

  62. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548941

    Description: epitope description:VDNQKQQHGALRNQGSRFHIKATHNFGD antigen name:Outer membrane protein P2 host organism:Homo sapiens

    Publication: 8500904;

  63. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548948

    Description: epitope description:DIVAKIAYGRTNYKYNESDEHKQQLNG antigen name:Outer membrane protein P2 host organism:Homo sapiens

    Publication: 8500904;

  64. Different B-cell responses to human T-cell lymphotropic virus type I (HTLV-I) envelope synthetic peptides in HTLV-I-infected individuals.

    ID: 1548951

    Description: epitope description:TLPFNWTHCFDPQIQAIVS antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1890164;

  65. Different B-cell responses to human T-cell lymphotropic virus type I (HTLV-I) envelope synthetic peptides in HTLV-I-infected individuals.

    ID: 1548952

    Description: epitope description:TLPFNWTHCFDPQIQAIVS antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1890164;

  66. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548955

    Description: epitope description:GEKTREQAVLFGVDHKLHKQLL antigen name:Outer membrane protein P2 host organism:Homo sapiens

    Publication: 8500904;

  67. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548957

    Description: epitope description:GEKTREQAVLFGVDHKLHKQLL antigen name:Outer membrane protein P2 host organism:Homo sapiens

    Publication: 8500904;

  68. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549258

    Description: epitope description:LPKPTLQGRLEA antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  69. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549259

    Description: epitope description:PKPTLQGRLEAD antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  70. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549261

    Description: epitope description:PTLQGRLEADFP antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  71. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549262

    Description: epitope description:TLQGRLEADFPD antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  72. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549263

    Description: epitope description:LQGRLEADFPDS antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  73. Identification of epitopes in cucumber mosaic virus using a phage-displayed random peptide library.

    ID: 1508970

    Description: epitope description:SLTTDEL host organism:Oryctolagus cuniculus

    Publication: 9880034;

  74. Identification of epitopes in cucumber mosaic virus using a phage-displayed random peptide library.

    ID: 1508974

    Description: epitope description:WHQVSLT host organism:Oryctolagus cuniculus

    Publication: 9880034;

  75. Identification of epitopes in cucumber mosaic virus using a phage-displayed random peptide library.

    ID: 1508978

    Description: epitope description:SGTSHIR host organism:Oryctolagus cuniculus

    Publication: 9880034;

  76. Identification of epitopes in cucumber mosaic virus using a phage-displayed random peptide library.

    ID: 1508981

    Description: epitope description:EHPWPLL host organism:Oryctolagus cuniculus

    Publication: 9880034;

  77. Identification of epitopes in cucumber mosaic virus using a phage-displayed random peptide library.

    ID: 1508989

    Description: epitope description:HSYTLMF host organism:Oryctolagus cuniculus

    Publication: 9880034;

  78. Identification of epitopes in cucumber mosaic virus using a phage-displayed random peptide library.

    ID: 1508990

    Description: epitope description:YHQTTIP host organism:Oryctolagus cuniculus

    Publication: 9880034;

  79. Identification of epitopes in cucumber mosaic virus using a phage-displayed random peptide library.

    ID: 1509010

    Description: epitope description:SPSAPTH host organism:Oryctolagus cuniculus antibody name:polyclonal antibody to PSV strain J

    Publication: 9880034;

  80. Identification of epitopes in cucumber mosaic virus using a phage-displayed random peptide library.

    ID: 1509012

    Description: epitope description:SSFSPST host organism:Oryctolagus cuniculus antibody name:polyclonal antibody to PSV strain J

    Publication: 9880034;

  81. Identification of epitopes in cucumber mosaic virus using a phage-displayed random peptide library.

    ID: 1509019

    Description: epitope description:LPYTMWV host organism:Oryctolagus cuniculus antibody name:polyclonal antibody to PSV strain J

    Publication: 9880034;

  82. Identification of epitopes in cucumber mosaic virus using a phage-displayed random peptide library.

    ID: 1509020

    Description: epitope description:TASFHRN host organism:Oryctolagus cuniculus antibody name:polyclonal antibody to PSV strain J

    Publication: 9880034;

  83. Identification of epitopes in cucumber mosaic virus using a phage-displayed random peptide library.

    ID: 1509026

    Description: epitope description:APWELPL host organism:Oryctolagus cuniculus antibody name:polyclonal antibody to PSV strain J

    Publication: 9880034;

  84. Use of synthetic peptides and site-specific antibodies to localize a diphtheria toxin sequence associated with ADP-ribosyltransferase activity.

    ID: 1509030

    Description: epitope description:ENFSSYHGTKPGYVDSI antigen name:Diphtheria toxin (UniProt:H2GU79) host organism:Mus musculus

    Publication: 8423159;

  85. Use of synthetic peptides and site-specific antibodies to localize a diphtheria toxin sequence associated with ADP-ribosyltransferase activity.

    ID: 1509037

    Description: epitope description:RLDAITGPEEEGGRLETILGWPLAER antigen name:Exotoxin A host organism:Mus musculus

    Publication: 8423159;

  86. Use of synthetic peptides and site-specific antibodies to localize a diphtheria toxin sequence associated with ADP-ribosyltransferase activity.

    ID: 1509041

    Description: epitope description:DNENPLSGKAGGVVKVTYPGLTKV antigen name:Diphtheria toxin (UniProt:H2GU79) host organism:Mus musculus

    Publication: 8423159;

  87. Use of synthetic peptides and site-specific antibodies to localize a diphtheria toxin sequence associated with ADP-ribosyltransferase activity.

    ID: 1509042

    Description: epitope description:KVDNAETIKKELGLSLTEP antigen name:Diphtheria toxin (UniProt:H2GU79) host organism:Mus musculus

    Publication: 8423159;

  88. Use of synthetic peptides and site-specific antibodies to localize a diphtheria toxin sequence associated with ADP-ribosyltransferase activity.

    ID: 1509047

    Description: epitope description:KVDNAETIKKELGLSLTEP antigen name:Diphtheria toxin (UniProt:H2GU79) host organism:Mus musculus

    Publication: 8423159;

  89. Epitope mapping of a monoclonal antibody specific to feline panleukopenia virus and mink enteritis virus.

    ID: 1509049

    Description: epitope description:K93 antigen name:Capsid protein VP1 host organism:Mus musculus antibody name:P2-215

    Publication: 9070987;

  90. HepG2 cell binding activities of different hepatitis B virus isolates: inhibitory effect of anti-HBs and anti-preS1(21-47).

    ID: 1509057

    Description: epitope description:NPDWDFNP antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:F35.25

    Publication: 1703368;

  91. Allergen mimotopes in food enhance type I allergic reactions in mice.

    ID: 1509068

    Description: epitope description:CFPYCYPSESA host organism:Oryctolagus cuniculus

    Publication: 10463950;

  92. Allergen mimotopes in food enhance type I allergic reactions in mice.

    ID: 1509069

    Description: epitope description:CFPYCYPSESA host organism:Homo sapiens

    Publication: 10463950;

  93. Epitope-specific antibody response to IgE by mimotope immunization.

    ID: 1509126

    Description: epitope description:CRRHNYGFWVC host organism:Mus musculus BALB/c antibody name:BSW17

    Publication: 9531289;

  94. Epitope-specific antibody response to IgE by mimotope immunization.

    ID: 1509132

    Description: epitope description:CTRLHTGYWVC host organism:Mus musculus BALB/c antibody name:BSW17

    Publication: 9531289;

  95. Mapping epitopes of neutralizing monoclonal antibodies using phage random peptide libraries.

    ID: 1509169

    Description: epitope description:QSSDSPPGGLQNDFP host organism:Mus musculus BALB/c antibody name:C1.3

    Publication: 9281855;

  96. Mapping epitopes of neutralizing monoclonal antibodies using phage random peptide libraries.

    ID: 1509171

    Description: epitope description:FPAGVANDPSVAGPF host organism:Mus musculus BALB/c antibody name:C1.3

    Publication: 9281855;

  97. Mapping epitopes of neutralizing monoclonal antibodies using phage random peptide libraries.

    ID: 1509174

    Description: epitope description:SAETIFDVTTLNPTIAGSDVAGLQNDPTTN host organism:Mus musculus BALB/c antibody name:C1.3

    Publication: 9281855;

  98. Sequences of antigenic epitopes of streptokinase identified via random peptide libraries displayed on phage.

    ID: 1509204

    Description: epitope description:IGCHFPSCFGPVWPS host organism:Mus musculus A/J antibody name:A2.5

    Publication: 9268662;

  99. Sequences of antigenic epitopes of streptokinase identified via random peptide libraries displayed on phage.

    ID: 1509205

    Description: epitope description:GDGRFHFLRGFFDSD host organism:Mus musculus A/J antibody name:A2.5

    Publication: 9268662;

  100. Sequences of antigenic epitopes of streptokinase identified via random peptide libraries displayed on phage.

    ID: 1509206

    Description: epitope description:PFWLRD host organism:Mus musculus BALB/c antibody name:9D10

    Publication: 9268662;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston