Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Epitope mapping of envelope glycoprotein E1 of hog cholera virus strain Brescia.

    ID: 1465643

    Description: epitope description:SVTFELLFDGTSPLTEEMGDDFGFGLCPYDTSPVVKGKYNTTLLNGSA antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:b...

    Publication: 7691986;

  2. Epitope mapping of envelope glycoprotein E1 of hog cholera virus strain Brescia.

    ID: 1465644

    Description: epitope description:CKEDHRYAISTTNEIGLHGAEGLT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:b6, b1, b5, b8

    Publication: 7691986;

  3. Characterization of rubella virus-specific antibody responses by using a new synthetic peptide-based enzyme-linked immunosorbent assay.

    ID: 1465647

    Description: epitope description:NQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Homo sapiens

    Publication: 1629342;

  4. Envelope proteins of human T cell leukemia virus type I: characterization by antisera to synthetic peptides and identification of a natural epitope.

    ID: 1465651

    Description: epitope description:QYAAQNRRGLDLL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2428880;

  5. Envelope proteins of human T cell leukemia virus type I: characterization by antisera to synthetic peptides and identification of a natural epitope.

    ID: 1465656

    Description: epitope description:QYAAQNRRGLDLL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2428880;

  6. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1465658

    Description: epitope description:KEARDQEMN antigen name:envelope polyprotein host organism:Mus musculus BALB/c antibody name:mAb 86

    Publication: 1370556;

  7. Molecular mimicry by Mycoplasma pneumoniae to evade the induction of adherence inhibiting antibodies.

    ID: 1473111

    Description: epitope description:PFNQWPDY antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Acute patient sera

    Publication: 7473675;

  8. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1473224

    Description: epitope description:TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAHRNQSLD antigen name:Der p 1 host organism:Homo sapiens antibody name:patient ser...

    Publication: 1940366;

  9. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1473226

    Description: epitope description:TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAHRNQSLD antigen name:Der p 1 host organism:Oryctolagus cuniculus antibody name:hy...

    Publication: 1940366;

  10. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1473238

    Description: epitope description:LAQPQRYCRHYWTIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWI antigen name:Der p 1 host organism:Oryctolagus cuniculus antibody name:h...

    Publication: 1940366;

  11. A method for the detection of IgE binding sequences of allergens based on a modification of epitope mapping.

    ID: 1473282

    Description: epitope description:SWCDPA antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 2474614;

  12. A method for the detection of IgE binding sequences of allergens based on a modification of epitope mapping.

    ID: 1473288

    Description: epitope description:ALTGCR antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 2474614;

  13. A method for the detection of IgE binding sequences of allergens based on a modification of epitope mapping.

    ID: 1473293

    Description: epitope description:LQCVGS antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 2474614;

  14. A method for the detection of IgE binding sequences of allergens based on a modification of epitope mapping.

    ID: 1473295

    Description: epitope description:GSQVPE antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 2474614;

  15. A method for the detection of IgE binding sequences of allergens based on a modification of epitope mapping.

    ID: 1473302

    Description: epitope description:QLADIN antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 2474614;

  16. Use of synthetic peptides to identify surface-exposed, linear B-cell epitopes within outer membrane protein F of Pseudomonas aeruginosa.

    ID: 1473483

    Description: epitope description:DLYGGSIGYFLTDDVELALSY antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 7580798;

  17. Use of synthetic peptides to identify surface-exposed, linear B-cell epitopes within outer membrane protein F of Pseudomonas aeruginosa.

    ID: 1473491

    Description: epitope description:GYGESRPVADN antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 7580798;

  18. Use of synthetic peptides to identify surface-exposed, linear B-cell epitopes within outer membrane protein F of Pseudomonas aeruginosa.

    ID: 1473493

    Description: epitope description:TDSVRNMKNADL antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 7580798;

  19. Use of synthetic peptides to identify surface-exposed, linear B-cell epitopes within outer membrane protein F of Pseudomonas aeruginosa.

    ID: 1473497

    Description: epitope description:EGHTDSVGTDAYNQK antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 7580798;

  20. Use of synthetic peptides to identify surface-exposed, linear B-cell epitopes within outer membrane protein F of Pseudomonas aeruginosa.

    ID: 1473498

    Description: epitope description:DVCSDSDNDGVCDNV antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 7580798;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston