Serologically defined linear epitopes in the E2 envelope glycoprotein of Semliki Forest virus.
ID: 1461624
Description: epitope description:REPTVIHGKREVTLHLHPDH antigen name:Structural polyprotein host organism:Mus musculus ICR antibody name:Mouse hyperimmune AF
Publication: 1696808;Serologically defined linear epitopes in the E2 envelope glycoprotein of Semliki Forest virus.
ID: 1461627
Description: epitope description:RTIPVPVDGMEYHWGNNDPV antigen name:Structural polyprotein host organism:Mus musculus ICR antibody name:Mouse hyperimmune AF
Publication: 1696808;Serologically defined linear epitopes in the E2 envelope glycoprotein of Semliki Forest virus.
ID: 1461631
Description: epitope description:LALISIFASCYMLVAARSKC antigen name:Structural polyprotein host organism:Mus musculus ICR antibody name:Mouse hyperimmune AF
Publication: 1696808;Identification of synthetic vaccine candidates against SARS CoV infection.
ID: 1462474
Description: epitope description:DSFKEELDKYFKNHTSPDVDLGDISGINASVV antigen name:Spike glycoprotein host organism:Cavia porcellus
Publication: 17506989;Identification of synthetic vaccine candidates against SARS CoV infection.
ID: 1462483
Description: epitope description:GNYNYKYRYLRHGKLRPFER antigen name:Spike glycoprotein host organism:Cavia porcellus
Publication: 17506989;