Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Serologically defined linear epitopes in the E2 envelope glycoprotein of Semliki Forest virus.

    ID: 1461624

    Description: epitope description:REPTVIHGKREVTLHLHPDH antigen name:Structural polyprotein host organism:Mus musculus ICR antibody name:Mouse hyperimmune AF

    Publication: 1696808;

  2. Serologically defined linear epitopes in the E2 envelope glycoprotein of Semliki Forest virus.

    ID: 1461627

    Description: epitope description:RTIPVPVDGMEYHWGNNDPV antigen name:Structural polyprotein host organism:Mus musculus ICR antibody name:Mouse hyperimmune AF

    Publication: 1696808;

  3. Serologically defined linear epitopes in the E2 envelope glycoprotein of Semliki Forest virus.

    ID: 1461631

    Description: epitope description:LALISIFASCYMLVAARSKC antigen name:Structural polyprotein host organism:Mus musculus ICR antibody name:Mouse hyperimmune AF

    Publication: 1696808;

  4. Identification of synthetic vaccine candidates against SARS CoV infection.

    ID: 1462474

    Description: epitope description:DSFKEELDKYFKNHTSPDVDLGDISGINASVV antigen name:Spike glycoprotein host organism:Cavia porcellus

    Publication: 17506989;

  5. Identification of synthetic vaccine candidates against SARS CoV infection.

    ID: 1462483

    Description: epitope description:GNYNYKYRYLRHGKLRPFER antigen name:Spike glycoprotein host organism:Cavia porcellus

    Publication: 17506989;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston