Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. A Trypanosoma cruzi small surface molecule provides the first immunological evidence that Chagas' disease is due to a single parasite lineage.

    ID: 1375561

    Description: epitope description:PGASSGEAEA antigen name:Mucin TcMUCII, putative (UniProt:K4DKV7) host organism:Homo sapiens

    Publication: 11854354;

  2. A Trypanosoma cruzi small surface molecule provides the first immunological evidence that Chagas' disease is due to a single parasite lineage.

    ID: 1375564

    Description: epitope description:GEAEASSNKND antigen name:Mucin TcMUCII, putative (UniProt:K4DKV7) host organism:Mus musculus BALB/c

    Publication: 11854354;

  3. A Trypanosoma cruzi small surface molecule provides the first immunological evidence that Chagas' disease is due to a single parasite lineage.

    ID: 1375566

    Description: epitope description:GEAEASSNKND antigen name:Mucin TcMUCII, putative (UniProt:K4DKV7) host organism:Homo sapiens

    Publication: 11854354;

  4. A Trypanosoma cruzi small surface molecule provides the first immunological evidence that Chagas' disease is due to a single parasite lineage.

    ID: 1375567

    Description: epitope description:SSNKNDGSLS antigen name:Mucin TcMUCII, putative (UniProt:K4DKV7) host organism:Mus musculus BALB/c

    Publication: 11854354;

  5. A Trypanosoma cruzi small surface molecule provides the first immunological evidence that Chagas' disease is due to a single parasite lineage.

    ID: 1375571

    Description: epitope description:GSLSSSAWVSA antigen name:Mucin TcMUCII, putative (UniProt:K4DKV7) host organism:Mus musculus BALB/c

    Publication: 11854354;

  6. Human cytomegalovirus structural proteins: immune reaction against pp150 synthetic peptides.

    ID: 1375575

    Description: epitope description:MKTVAFDLSSPQKSGTGPQPGSAGMGGAKTPSDAVQNILQKIEKIKNTEE antigen name:Tegument protein pp150 host organism:Homo sapiens

    Publication: 1723077;

  7. Peptides that mimic Candida albicans-derived beta-1,2-linked mannosides.

    ID: 1375578

    Description: epitope description:FHENWPS host organism:Mus musculus antibody name:anti-peptide (FHENWPS)

    Publication: 11479280;

  8. Human cytomegalovirus structural proteins: immune reaction against pp150 synthetic peptides.

    ID: 1375588

    Description: epitope description:KSGTGPQPGSAGMGGAKTPSDAVQNISQKIEKIKNTEE antigen name:Other Human betaherpesvirus 5 (Human cytomegalovirus) protein host organism:Ho...

    Publication: 1723077;

  9. Human cytomegalovirus structural proteins: immune reaction against pp150 synthetic peptides.

    ID: 1375591

    Description: epitope description:GGAKTPSDAVQNISQKIEKIKNTEE antigen name:Other Human betaherpesvirus 5 (Human cytomegalovirus) protein host organism:Homo sapiens

    Publication: 1723077;

  10. Human cytomegalovirus structural proteins: immune reaction against pp150 synthetic peptides.

    ID: 1375594

    Description: epitope description:RPLTETRGDLFSGDEDSDSSD antigen name:Tegument protein pp150 host organism:Homo sapiens

    Publication: 1723077;

  11. Human cytomegalovirus structural proteins: immune reaction against pp150 synthetic peptides.

    ID: 1375596

    Description: epitope description:TKASPGRVRRDSAWDVRPLTETRGDLFSGDEDSDSSD antigen name:Tegument protein pp150 host organism:Homo sapiens

    Publication: 1723077;

  12. Human cytomegalovirus structural proteins: immune reaction against pp150 synthetic peptides.

    ID: 1375604

    Description: epitope description:QQQPPPPARKPSASRRLPGSSADEDDDDDDDEKN antigen name:Other Human betaherpesvirus 5 (Human cytomegalovirus) protein host organism:Homo s...

    Publication: 1723077;

  13. Human cytomegalovirus structural proteins: immune reaction against pp150 synthetic peptides.

    ID: 1375605

    Description: epitope description:QQQPPPPARKPSASRRLPGSSADEDDDDDDDEKN antigen name:Other Human betaherpesvirus 5 (Human cytomegalovirus) protein host organism:Homo s...

    Publication: 1723077;

  14. Mapping of a B-cell epitope present in the neuraminidase of Trypanosoma cruzi.

    ID: 1375607

    Description: epitope description:YSVDDGETWE antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Homo sapiens

    Publication: 1378212;

  15. Herpes simplex virus type 1-specific immunity induced by peptides corresponding to an antigenic site of glycoprotein B.

    ID: 1375615

    Description: epitope description:TPPRPAGDNATVAAGHAT antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c

    Publication: 1698994;

  16. A subset of type-specific epitopes map in the amino terminus of herpes simplex virus type 1 glycoprotein B.

    ID: 1375620

    Description: epitope description:PLSRVDLGDCI antigen name:Envelope glycoprotein B host organism:Mus musculus antibody name:H1392, H1396, H1397 and H1839

    Publication: 2471797;

  17. Trypanosoma cruzi: conformational preferences of antigenic peptides bearing the immunodominant epitope of the B13 antigen.

    ID: 1375637

    Description: epitope description:GDKPSLFGQAAAGDKPSLF antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

    Publication: 10464037;

  18. Trypanosoma cruzi surface mucins with exposed variant epitopes.

    ID: 1375667

    Description: epitope description:TASGQKAEQDT antigen name:Mucin TcMUCII, putative (UniProt:K4DSH9) host organism:Homo sapiens

    Publication: 10843987;

  19. Trypanosoma cruzi surface mucins with exposed variant epitopes.

    ID: 1375670

    Description: epitope description:AESVSQNN antigen name:Mucin TcMUCII, putative (UniProt:K4DVA4) host organism:Mus musculus

    Publication: 10843987;

  20. Sequence homology and immunologic cross-reactivity of human cytomegalovirus with HLA-DR beta chain: a means for graft rejection and immunosuppression.

    ID: 1375700

    Description: epitope description:LGRPDEDSSSSSSSC antigen name:Viral transcription factor IE2 host organism:Oryctolagus cuniculus

    Publication: 2446012;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston