Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590143

    Description: epitope description:NVPKINPKKD antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  2. A peptide-based human T cell leukemia virus type I vaccine containing T and B cell epitopes that induces high titers of neutralizing antibodies.

    ID: 1590151

    Description: epitope description:LPHSNLDHIL antigen name:Envelope glycoprotein gp62 host organism:Rattus norvegicus WKAH

    Publication: 7527817;

  3. Genetic and antigenic variation of capsid protein VP7 of serotype G1 human rotavirus isolates.

    ID: 1590164

    Description: epitope description:N94 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV4:3

    Publication: 10073693;

  4. Cross-reactive and serotype-specific neutralization epitopes on VP7 of human rotavirus: nucleotide sequence analysis of antigenic mutants selected wit...

    ID: 1590166

    Description: epitope description:D213 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus antibody name:KU-4

    Publication: 2452893;

  5. Cross-reactive and serotype-specific neutralization epitopes on VP7 of human rotavirus: nucleotide sequence analysis of antigenic mutants selected wit...

    ID: 1590180

    Description: epitope description:N94 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus antibody name:YO-4C2

    Publication: 2452893;

  6. Cross-reactive and serotype-specific neutralization epitopes on VP7 of human rotavirus: nucleotide sequence analysis of antigenic mutants selected wit...

    ID: 1590192

    Description: epitope description:W98 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus antibody name:YO-4C2

    Publication: 2452893;

  7. Human IgE binding capacity of tryptic peptides from bovine alpha-lactalbumin.

    ID: 1590238

    Description: epitope description:IWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKK + MCM(C3, C15, C19, C33) antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 9250594;

  8. Human IgE binding capacity of tryptic peptides from bovine alpha-lactalbumin.

    ID: 1590239

    Description: epitope description:ALCSEKLDQWLCEKL + MCM(C3, C12) antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 9250594;

  9. Human IgE binding capacity of tryptic peptides from bovine alpha-lactalbumin.

    ID: 1590249

    Description: epitope description:IWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVK + MCM(C3, C15, C19, C33) antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 9250594;

  10. Mapping of B-cell epitopes on the outer membrane P2 porin protein of Haemophilus influenzae by using recombinant proteins and synthetic peptides.

    ID: 1593073

    Description: epitope description:GANYLLAQKREGAKGENKRPNDKAGEV antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:P2-3

    Publication: 1706322;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston