Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Molecular mimicry between the immunodominant ribosomal protein P0 of Trypanosoma cruzi and a functional epitope on the human beta 1-adrenergic recepto...

    ID: 1372462

    Description: epitope description:AESEE antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

    Publication: 7790824;

  2. Analysis of the antigenic properties of the L. infantum Hsp70: design of synthetic peptides for specific serodiagnosis of human leishmaniasis.

    ID: 1372601

    Description: epitope description:NDQGNRTTPSYVAFTDSERL antigen name:Putative heat-shock protein hsp70 host organism:Homo sapiens antibody name:patient sera

    Publication: 9840686;

  3. Analysis of the antigenic properties of the L. infantum Hsp70: design of synthetic peptides for specific serodiagnosis of human leishmaniasis.

    ID: 1372604

    Description: epitope description:RKFNDSVVQSDMKHWPFKVT antigen name:Putative heat-shock protein hsp70 host organism:Homo sapiens antibody name:patient sera

    Publication: 9840686;

  4. Analysis of the antigenic properties of the L. infantum Hsp70: design of synthetic peptides for specific serodiagnosis of human leishmaniasis.

    ID: 1372605

    Description: epitope description:VQYRGEEKTFTPEEISSMVL antigen name:Putative heat-shock protein hsp70 host organism:Homo sapiens antibody name:patient sera

    Publication: 9840686;

  5. Analysis of the antigenic properties of the L. infantum Hsp70: design of synthetic peptides for specific serodiagnosis of human leishmaniasis.

    ID: 1372631

    Description: epitope description:KNGLENYAYSMKNTLSDSNV antigen name:Putative heat-shock protein hsp70 host organism:Homo sapiens antibody name:patient sera

    Publication: 9840686;

  6. Analysis of the antigenic properties of the L. infantum Hsp70: design of synthetic peptides for specific serodiagnosis of human leishmaniasis.

    ID: 1372639

    Description: epitope description:VCNPIMTKMYQSMGGAAGGMPGGMPGMSGMSGGAGPAGGASSGPKVEEVD antigen name:Putative heat-shock protein hsp70 host organism:Homo sapiens antib...

    Publication: 9840686;

  7. Analysis of the antigenic properties of the L. infantum Hsp70: design of synthetic peptides for specific serodiagnosis of human leishmaniasis.

    ID: 1372650

    Description: epitope description:TLSDSNVSGKLEDSDKATLNKEIDVVLEWLSSNQEAAKEEYEHKQKELES antigen name:Putative heat-shock protein hsp70 host organism:Homo sapiens antib...

    Publication: 9840686;

  8. Antibodies to an epitope from the Cha human autoantigen are markers of Chagas' disease.

    ID: 1372298

    Description: epitope description:MRQLDTNVERRALGEIQNV antigen name:Transcription factor-like 5 protein host organism:Homo sapiens

    Publication: 11687436;

  9. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372307

    Description: epitope description:GVGAGGGDQNNLIGQFGVGF antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Homo sapiens

    Publication: 11803053;

  10. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372308

    Description: epitope description:YSVFLVGDRVRVASKSDDSD antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Homo sapiens

    Publication: 11803053;

  11. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372314

    Description: epitope description:TQGVVKERRWTLVNENRPIW antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Homo sapiens

    Publication: 11803053;

  12. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372317

    Description: epitope description:DSILFVPTTVDPASFSDDNS antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Homo sapiens

    Publication: 11803053;

  13. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372321

    Description: epitope description:LVRKTLSMFADIAAQDEAIA antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Homo sapiens

    Publication: 11803053;

  14. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372327

    Description: epitope description:HDVEVIFMTDAIDEYVVSQL antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Homo sapiens

    Publication: 11803053;

  15. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372339

    Description: epitope description:TVSAGDGRGTPIAFQAEVSK antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Mesocricetus auratus HsdHan:Aura

    Publication: 11803053;

  16. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372346

    Description: epitope description:YSVFLVGDRVRVASKSDDSD antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Mesocricetus auratus HsdHan:Aura

    Publication: 11803053;

  17. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372353

    Description: epitope description:TRPIGNVTEEEYHTFYKAFS antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Mesocricetus auratus HsdHan:Aura

    Publication: 11803053;

  18. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372354

    Description: epitope description:GDYRDPLYFNHFKVEGEVDF antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Mesocricetus auratus HsdHan:Aura

    Publication: 11803053;

  19. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372355

    Description: epitope description:DSILFVPTTVDPASFSDDNS antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Mesocricetus auratus HsdHan:Aura

    Publication: 11803053;

  20. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372366

    Description: epitope description:TDFAGKKLINLAKEGVQLEE antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Mesocricetus auratus HsdHan:Aura

    Publication: 11803053;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston