Epitope mapping porcine reproductive and respiratory syndrome virus by phage display: the nsp2 fragment of the replicase polyprotein contains a cluste...

ID: 1479231

Description: epitope description:QPLNLSLAAWP antigen name:Replicase polyprotein 1ab host organism:Sus scrofa antibody name:42-dpi

Synthetic peptides induce antibody against a host-protective antigen of Echinococcus granulosus.

ID: 1479255

Description: epitope description:TETPLRKHFNLTPV antigen name:Antigen protein host organism:Ovis aries antibody name:sheep serum

Effect of adjuvant composition on immune response to a multiple antigen peptide (MAP) containing a protective epitope from Neisseria meningitidis clas...

ID: 1479326

Description: epitope description:TKNTNNNLTL antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c antibody name:mouse serum

Posttranslational processing and identification of a neutralization domain of the GP4 protein encoded by ORF4 of Lelystad virus.

ID: 1479342

Description: epitope description:AAAGFMVLQDINCFRPHGVSAAQEKISFGKSSQCREAVGT antigen name:Glycoprotein 4 host organism:Mus musculus antibody name:121.4, 122.1, 122.20...

Posttranslational processing and identification of a neutralization domain of the GP4 protein encoded by ORF4 of Lelystad virus.

ID: 1479346

Description: epitope description:AAAGFMVLQDINCFRPHGVSAAQEKISFGKSSQCREAVGT antigen name:Glycoprotein 4 host organism:Mus musculus antibody name:122.1, 122.20, 122.5...