Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422434

    Description: epitope description:SNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cunicu...

    Publication: 7506298;

  2. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422436

    Description: epitope description:REFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zealand Whit...

    Publication: 7506298;

  3. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422437

    Description: epitope description:SELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabb...

    Publication: 7506298;

  4. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422439

    Description: epitope description:SNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/...

    Publication: 7506298;

  5. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423405

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  6. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423414

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  7. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423416

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  8. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423434

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  9. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423435

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  10. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423437

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston