Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Sequences of antigenic epitopes of streptokinase identified via random peptide libraries displayed on phage.

    ID: 1509207

    Description: epitope description:PFWLSD host organism:Mus musculus BALB/c antibody name:9D10

    Publication: 9268662;

  2. Sequences of antigenic epitopes of streptokinase identified via random peptide libraries displayed on phage.

    ID: 1509209

    Description: epitope description:QKSKPF host organism:Mus musculus BALB/c antibody name:10E1

    Publication: 9268662;

  3. Use of immunoreactive synthetic HTLV-1 peptides in the search for antibody reactivity in multiple sclerosis.

    ID: 1509223

    Description: epitope description:LPPTAPPLLPHSNLDHILEPSIPW antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1546533;

  4. Importance of an immunodominant surface-exposed loop on outer membrane protein P2 of nontypeable Haemophilus influenzae.

    ID: 1509259

    Description: epitope description:EQSSSTEDNQEQQHGALRNQGS antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cuniculus

    Publication: 8975905;

  5. Importance of an immunodominant surface-exposed loop on outer membrane protein P2 of nontypeable Haemophilus influenzae.

    ID: 1509263

    Description: epitope description:QERDLRTLDSRTNPTKSGEVT antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cuniculus

    Publication: 8975905;

  6. Importance of an immunodominant surface-exposed loop on outer membrane protein P2 of nontypeable Haemophilus influenzae.

    ID: 1509274

    Description: epitope description:EDKEYGLLNSKKYIPTNGN antigen name:Other Haemophilus influenzae protein host organism:Mus musculus

    Publication: 8975905;

  7. Importance of an immunodominant surface-exposed loop on outer membrane protein P2 of nontypeable Haemophilus influenzae.

    ID: 1509285

    Description: epitope description:TNYKDSNHSYTQKIPKANAADADTDTTIIYPHHGKKQEVNGALASL antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cunicul...

    Publication: 8975905;

  8. Scrapie-associated precursor proteins: antigenic relationship between species and immunocytochemical localization in normal, scrapie, and Creutzfeldt-...

    ID: 1509294

    Description: epitope description:GQGGGTHNQWNKPSK antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 1969126;

  9. Scrapie-associated precursor proteins: antigenic relationship between species and immunocytochemical localization in normal, scrapie, and Creutzfeldt-...

    ID: 1509296

    Description: epitope description:GQGGGTHNQWNKPSK antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 1969126;

  10. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509299

    Description: epitope description:KTKRNTNRRPQDVKF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  11. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509301

    Description: epitope description:GPRLGVRATRKTSERSQP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  12. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509302

    Description: epitope description:ATRKTSERSQPRGRRQPI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  13. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509310

    Description: epitope description:YPGHVSGHRMAWDMM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  14. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509314

    Description: epitope description:AADMIMHTPGCVPCV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  15. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509315

    Description: epitope description:SRCWVALTPTLAARN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  16. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509316

    Description: epitope description:AARNSSIPTTTIRRHVDL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  17. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509318

    Description: epitope description:SPRRYETVQDCNCSLYPG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  18. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509322

    Description: epitope description:NETDVLLLNNTRPPQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  19. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509323

    Description: epitope description:DCFRKHPEATYTKCGSGP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  20. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509337

    Description: epitope description:NCTYFCG antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  21. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509342

    Description: epitope description:CGRNAYC antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  22. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509346

    Description: epitope description:AYCNEEC antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  23. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509352

    Description: epitope description:CTKLKGE antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  24. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509362

    Description: epitope description:CQWASPY antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  25. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509366

    Description: epitope description:SPYGNAC antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  26. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509367

    Description: epitope description:PYGNACY antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  27. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509370

    Description: epitope description:NACYCYK antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  28. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509371

    Description: epitope description:ACYCYKL antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  29. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509375

    Description: epitope description:YKLPDHV antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  30. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509379

    Description: epitope description:PDHVRTK antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  31. Mapping epitopes of neutralizing monoclonal antibodies using phage random peptide libraries.

    ID: 1509398

    Description: epitope description:TPGYKNDALSHFHLT host organism:Mus musculus BALB/c antibody name:C1.3

    Publication: 9281855;

  32. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590091

    Description: epitope description:VQPQVNKEIR antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  33. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590100

    Description: epitope description:AYGIKSNVVR antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  34. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590104

    Description: epitope description:ADTIQKGFYY antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  35. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590109

    Description: epitope description:AGIRPKGAFQ antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  36. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590112

    Description: epitope description:KQMGQTGGSY antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  37. A peptide-based human T cell leukemia virus type I vaccine containing T and B cell epitopes that induces high titers of neutralizing antibodies.

    ID: 1590129

    Description: epitope description:SQLPPTAPPLLPHSNLDHILEPSIPWKSKL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7527817;

  38. A peptide-based human T cell leukemia virus type I vaccine containing T and B cell epitopes that induces high titers of neutralizing antibodies.

    ID: 1590130

    Description: epitope description:SQLPPTAPPLLPHSNLDHILEPSIPWKSKL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7527817;

  39. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590135

    Description: epitope description:VQPQVNKEIR antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  40. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590139

    Description: epitope description:PQEIRDVLSK antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  41. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590143

    Description: epitope description:NVPKINPKKD antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  42. A peptide-based human T cell leukemia virus type I vaccine containing T and B cell epitopes that induces high titers of neutralizing antibodies.

    ID: 1590151

    Description: epitope description:LPHSNLDHIL antigen name:Envelope glycoprotein gp62 host organism:Rattus norvegicus WKAH

    Publication: 7527817;

  43. Genetic and antigenic variation of capsid protein VP7 of serotype G1 human rotavirus isolates.

    ID: 1590164

    Description: epitope description:N94 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV4:3

    Publication: 10073693;

  44. Cross-reactive and serotype-specific neutralization epitopes on VP7 of human rotavirus: nucleotide sequence analysis of antigenic mutants selected wit...

    ID: 1590166

    Description: epitope description:D213 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus antibody name:KU-4

    Publication: 2452893;

  45. Cross-reactive and serotype-specific neutralization epitopes on VP7 of human rotavirus: nucleotide sequence analysis of antigenic mutants selected wit...

    ID: 1590180

    Description: epitope description:N94 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus antibody name:YO-4C2

    Publication: 2452893;

  46. Cross-reactive and serotype-specific neutralization epitopes on VP7 of human rotavirus: nucleotide sequence analysis of antigenic mutants selected wit...

    ID: 1590192

    Description: epitope description:W98 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus antibody name:YO-4C2

    Publication: 2452893;

  47. Human IgE binding capacity of tryptic peptides from bovine alpha-lactalbumin.

    ID: 1590238

    Description: epitope description:IWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKK + MCM(C3, C15, C19, C33) antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 9250594;

  48. Human IgE binding capacity of tryptic peptides from bovine alpha-lactalbumin.

    ID: 1590239

    Description: epitope description:ALCSEKLDQWLCEKL + MCM(C3, C12) antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 9250594;

  49. Human IgE binding capacity of tryptic peptides from bovine alpha-lactalbumin.

    ID: 1590249

    Description: epitope description:IWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVK + MCM(C3, C15, C19, C33) antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 9250594;

  50. Mapping of B-cell epitopes on the outer membrane P2 porin protein of Haemophilus influenzae by using recombinant proteins and synthetic peptides.

    ID: 1593073

    Description: epitope description:GANYLLAQKREGAKGENKRPNDKAGEV antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:P2-3

    Publication: 1706322;

  51. Mapping of B-cell epitopes on the outer membrane P2 porin protein of Haemophilus influenzae by using recombinant proteins and synthetic peptides.

    ID: 1593083

    Description: epitope description:VDNQKQQHGALRNQGSRFHIKATHNFGD antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:P2-17

    Publication: 1706322;

  52. Mapping of B-cell epitopes on the outer membrane P2 porin protein of Haemophilus influenzae by using recombinant proteins and synthetic peptides.

    ID: 1593086

    Description: epitope description:ARTRTTETGKGVKTEKEKSVGVGLRVYF antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:P2-10

    Publication: 1706322;

  53. Mapping of B-cell epitopes on the outer membrane P2 porin protein of Haemophilus influenzae by using recombinant proteins and synthetic peptides.

    ID: 1593089

    Description: epitope description:EGAKGENKRPNDKAGEV antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:P2-3

    Publication: 1706322;

  54. Mapping of B-cell epitopes on the outer membrane P2 porin protein of Haemophilus influenzae by using recombinant proteins and synthetic peptides.

    ID: 1593093

    Description: epitope description:EGAKGENKRPNDKAGEV antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:P2-7

    Publication: 1706322;

  55. Mapping of B-cell epitopes on the outer membrane P2 porin protein of Haemophilus influenzae by using recombinant proteins and synthetic peptides.

    ID: 1593095

    Description: epitope description:EGAKGENKRPNDKAGEV antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:P2-12

    Publication: 1706322;

  56. Identification of common epitopes on gliadin, enterocytes, and calreticulin recognised by antigliadin antibodies of patients with coeliac disease.

    ID: 1593108

    Description: epitope description:YPQPQPFPSQQP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens antibody name:an...

    Publication: 9895374;

  57. Identification of common epitopes on gliadin, enterocytes, and calreticulin recognised by antigliadin antibodies of patients with coeliac disease.

    ID: 1593111

    Description: epitope description:FPQPQLPYSQPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens antibody name:an...

    Publication: 9895374;

  58. Identification of common epitopes on gliadin, enterocytes, and calreticulin recognised by antigliadin antibodies of patients with coeliac disease.

    ID: 1593113

    Description: epitope description:PFRPQQPYPQPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens antibody name:an...

    Publication: 9895374;

  59. Identification of common epitopes on gliadin, enterocytes, and calreticulin recognised by antigliadin antibodies of patients with coeliac disease.

    ID: 1593118

    Description: epitope description:LQQQLIPCMDVV antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens antibody name:an...

    Publication: 9895374;

  60. Identification of common epitopes on gliadin, enterocytes, and calreticulin recognised by antigliadin antibodies of patients with coeliac disease.

    ID: 1593120

    Description: epitope description:LQQHNIAHGRSQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens antibody name:an...

    Publication: 9895374;

  61. Peptide vaccines incorporating a 'promiscuous' T-cell epitope bypass certain haplotype restricted immune responses and provide broad spectrum immunoge...

    ID: 1593183

    Description: epitope description:EEEGLLKKSADTLWNMQK antigen name:L-lactate dehydrogenase C chain host organism:Mus musculus C57BL/10

    Publication: 7508238;

  62. Identification of common epitopes on gliadin, enterocytes, and calreticulin recognised by antigliadin antibodies of patients with coeliac disease.

    ID: 1593263

    Description: epitope description:EEIRNLALQTLP antigen name:Tri a 21 host organism:Homo sapiens antibody name:anti-gliadin antibodies (AGA)

    Publication: 9895374;

  63. Immune recognition of linear antigenic regions within the hepatitis B pre-C and C-gene translation products using synthetic peptides.

    ID: 1593325

    Description: epitope description:MDIDPYKEFG antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7508491;

  64. Immune recognition of linear antigenic regions within the hepatitis B pre-C and C-gene translation products using synthetic peptides.

    ID: 1593331

    Description: epitope description:LDTASALYRE antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7508491;

  65. Immune recognition of linear antigenic regions within the hepatitis B pre-C and C-gene translation products using synthetic peptides.

    ID: 1593333

    Description: epitope description:ALESPEHCSP antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7508491;

  66. Immune recognition of linear antigenic regions within the hepatitis B pre-C and C-gene translation products using synthetic peptides.

    ID: 1593335

    Description: epitope description:HHTALRQAIL antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7508491;

  67. Immune recognition of linear antigenic regions within the hepatitis B pre-C and C-gene translation products using synthetic peptides.

    ID: 1593336

    Description: epitope description:RQAILCWGEL antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7508491;

  68. Immune recognition of linear antigenic regions within the hepatitis B pre-C and C-gene translation products using synthetic peptides.

    ID: 1593343

    Description: epitope description:TNMGLKFRQL antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7508491;

  69. Immune recognition of linear antigenic regions within the hepatitis B pre-C and C-gene translation products using synthetic peptides.

    ID: 1593344

    Description: epitope description:KFRQLLWFHI antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7508491;

  70. Immune recognition of linear antigenic regions within the hepatitis B pre-C and C-gene translation products using synthetic peptides.

    ID: 1593347

    Description: epitope description:GRETVIEYLV antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7508491;

  71. Immune recognition of linear antigenic regions within the hepatitis B pre-C and C-gene translation products using synthetic peptides.

    ID: 1593348

    Description: epitope description:IEYLVSFGVW antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7508491;

  72. Immune recognition of linear antigenic regions within the hepatitis B pre-C and C-gene translation products using synthetic peptides.

    ID: 1593349

    Description: epitope description:SFGVWIRTPP antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7508491;

  73. Immune recognition of linear antigenic regions within the hepatitis B pre-C and C-gene translation products using synthetic peptides.

    ID: 1593358

    Description: epitope description:RRSQSPRRRR antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7508491;

  74. Immune recognition of linear antigenic regions within the hepatitis B pre-C and C-gene translation products using synthetic peptides.

    ID: 1593378

    Description: epitope description:MDIDPYKEFGATVELLSFLP antigen name:Capsid protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7508491;

  75. Extensive antigenic polymorphism within the repeat sequence of the Plasmodium falciparum merozoite surface protein 1 block 2 is incorporated in a mini...

    ID: 1593482

    Description: epitope description:SAQSGTSGTSGT antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 16113313;

  76. Extensive antigenic polymorphism within the repeat sequence of the Plasmodium falciparum merozoite surface protein 1 block 2 is incorporated in a mini...

    ID: 1593504

    Description: epitope description:SAQSGASAQSGA antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 16113313;

  77. Extensive antigenic polymorphism within the repeat sequence of the Plasmodium falciparum merozoite surface protein 1 block 2 is incorporated in a mini...

    ID: 1593505

    Description: epitope description:SGTSAQSGTSAQ antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 16113313;

  78. Extensive antigenic polymorphism within the repeat sequence of the Plasmodium falciparum merozoite surface protein 1 block 2 is incorporated in a mini...

    ID: 1593506

    Description: epitope description:SGTSAQSGTSGT antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 16113313;

  79. Extensive antigenic polymorphism within the repeat sequence of the Plasmodium falciparum merozoite surface protein 1 block 2 is incorporated in a mini...

    ID: 1593512

    Description: epitope description:SGTSGPSGTSGP antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 16113313;

  80. Extensive antigenic polymorphism within the repeat sequence of the Plasmodium falciparum merozoite surface protein 1 block 2 is incorporated in a mini...

    ID: 1593514

    Description: epitope description:SGTSGPSGPSGP antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 16113313;

  81. Extensive antigenic polymorphism within the repeat sequence of the Plasmodium falciparum merozoite surface protein 1 block 2 is incorporated in a mini...

    ID: 1593516

    Description: epitope description:SGASAQSGTSGT antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 16113313;

  82. Binding of a neutralizing antibody to dengue virus alters the arrangement of surface glycoproteins.

    ID: 1594094

    Description: epitope description:K585, F586, K587, V588, V589, K590, I592, Q605, P644, K668, N670 antigen name:Genome polyprotein host organism:Mus musculus BALB/c...

    Publication: 18264114;

  83. Epitope mapping of the house-dust-mite allergen Der p 2 by means of site-directed mutagenesis.

    ID: 1594098

    Description: epitope description:G84, D86, C90, H91, Y92, M93, K94, C95, I105, K106, Y107 antigen name:Der p 2 host organism:Mus musculus BALB/c antibody name:alph...

    Publication: 9534915;

  84. Two mechanisms of antigenic diversification of foot-and-mouth disease virus.

    ID: 1594104

    Description: epitope description:TGVRRGDLAHLAAA antigen name:Polyprotein host organism:Mus musculus antibody name:7CA11, 7JD1, 7FC12, 7AH1, 7EE6, 7AB5

    Publication: 1653494;

  85. Nuclear magnetic resonance structure and IgE epitopes of Blo t 5, a major dust mite allergen.

    ID: 1594108

    Description: epitope description:LLIEQANHAIEKGEHQ antigen name:Blo t 5 host organism:Homo sapiens

    Publication: 18684949;

  86. Nuclear magnetic resonance structure and IgE epitopes of Blo t 5, a major dust mite allergen.

    ID: 1594110

    Description: epitope description:AIEKGEHQLLYLQHQL antigen name:Blo t 5 host organism:Homo sapiens

    Publication: 18684949;

  87. Nuclear magnetic resonance structure and IgE epitopes of Blo t 5, a major dust mite allergen.

    ID: 1594112

    Description: epitope description:LLYLQHQLDELNENKS antigen name:Blo t 5 host organism:Homo sapiens

    Publication: 18684949;

  88. Nuclear magnetic resonance structure and IgE epitopes of Blo t 5, a major dust mite allergen.

    ID: 1594115

    Description: epitope description:VVCAMIEGAQGALERE antigen name:Blo t 5 host organism:Homo sapiens

    Publication: 18684949;

  89. Nuclear magnetic resonance structure and IgE epitopes of Blo t 5, a major dust mite allergen.

    ID: 1594116

    Description: epitope description:MIEGAQGALERELKRT antigen name:Blo t 5 host organism:Homo sapiens

    Publication: 18684949;

  90. Anti-calreticulin immunoglobulin A (IgA) antibodies in refractory coeliac disease.

    ID: 1594138

    Description: epitope description:KLFPNSLDQT antigen name:Calreticulin host organism:Homo sapiens antibody name:RCD patient sera

    Publication: 18637103;

  91. Anti-calreticulin immunoglobulin A (IgA) antibodies in refractory coeliac disease.

    ID: 1594142

    Description: epitope description:AKIDDPTDSK antigen name:Calreticulin host organism:Homo sapiens antibody name:RCD patient sera

    Publication: 18637103;

  92. Anti-calreticulin immunoglobulin A (IgA) antibodies in refractory coeliac disease.

    ID: 1594148

    Description: epitope description:AAEKQMKDKQ antigen name:Calreticulin host organism:Homo sapiens antibody name:RCD patient sera

    Publication: 18637103;

  93. Anti-calreticulin immunoglobulin A (IgA) antibodies in refractory coeliac disease.

    ID: 1594149

    Description: epitope description:EKQMKDKQDE antigen name:Calreticulin host organism:Homo sapiens antibody name:RCD patient sera

    Publication: 18637103;

  94. Anti-calreticulin immunoglobulin A (IgA) antibodies in refractory coeliac disease.

    ID: 1594150

    Description: epitope description:KQDEEQRLKE antigen name:Calreticulin host organism:Homo sapiens antibody name:RCD patient sera

    Publication: 18637103;

  95. Anti-calreticulin immunoglobulin A (IgA) antibodies in refractory coeliac disease.

    ID: 1594152

    Description: epitope description:RLKEEEEDKK antigen name:Calreticulin host organism:Homo sapiens antibody name:RCD patient sera

    Publication: 18637103;

  96. Anti-calreticulin immunoglobulin A (IgA) antibodies in refractory coeliac disease.

    ID: 1594157

    Description: epitope description:EEEEAEDKED antigen name:Calreticulin host organism:Homo sapiens antibody name:RCD patient sera

    Publication: 18637103;

  97. Anti-calreticulin immunoglobulin A (IgA) antibodies in refractory coeliac disease.

    ID: 1594162

    Description: epitope description:DEEDKEEDEE antigen name:Calreticulin host organism:Homo sapiens antibody name:RCD patient sera

    Publication: 18637103;

  98. Anti-calreticulin immunoglobulin A (IgA) antibodies in refractory coeliac disease.

    ID: 1594167

    Description: epitope description:AEDKEDDAED host organism:Homo sapiens antibody name:CD patient sera

    Publication: 18637103;

  99. Structural and immunological characterization of Friend murine leukaemia virus glycopolypeptide using synthetic oligopeptides.

    ID: 1594225

    Description: epitope description:PKPAKSP antigen name:Envelope glycoprotein host organism:Oryctolagus cuniculus

    Publication: 6479153;

  100. Identification of the p53 protein domain involved in formation of the simian virus 40 large T-antigen-p53 protein complex.

    ID: 1594394

    Description: epitope description:SDISLELPLSQETFSGL antigen name:Cellular tumor antigen p53 host organism:Mus musculus BALB/c antibody name:PAb242-JY

    Publication: 3016321;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston