Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "
  1. A monoclonal anti-IgE antibody against an epitope (amino acids 367-376) in the CH3 domain inhibits IgE binding to the low affinity IgE receptor (CD23)...

    ID: 1594401

    Description: epitope description:KGTVNLTWSR antigen name:Immunoglobulin host organism:Mus musculus BALB/c antibody name:mAb 27

    Publication: 2459242;
  2. A mimotope from a solid-phase peptide library induces a measles virus-neutralizing and protective antibody response.

    ID: 1594582

    Description: epitope description:NIIRTKKQ host organism:Mus musculus BALB/c

    Publication: 7494275;
  3. A mimotope from a solid-phase peptide library induces a measles virus-neutralizing and protective antibody response.

    ID: 1594584

    Description: epitope description:QFFRRMDY host organism:Mus musculus BALB/c

    Publication: 7494275;
  4. A mimotope from a solid-phase peptide library induces a measles virus-neutralizing and protective antibody response.

    ID: 1594590

    Description: epitope description:IAAQKPKV host organism:Mus musculus BALB/c

    Publication: 7494275;
  5. A mimotope from a solid-phase peptide library induces a measles virus-neutralizing and protective antibody response.

    ID: 1594602

    Description: epitope description:IAAQKPKV host organism:Mus musculus BALB/c

    Publication: 7494275;
  6. Fine specificity of the genetically controlled immune response to native and recombinant gp15/400 (polyprotein allergen) of Brugia malayi.

    ID: 1594611

    Description: epitope description:IVGDEKMAELKQMKESGLGQEELRAKVDEMLEHVTDEAKKQKIH antigen name:BMA-NPA-1, isoform a host organism:Mus musculus

    Publication: 7622210;
  7. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594651

    Description: epitope description:DAPKTFSMGAKPTGSAAANYTTAVDRPNPA antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

    Publication: 8757875;
  8. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594667

    Description: epitope description:TDSFSDFM antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

    Publication: 8757875;
  9. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594670

    Description: epitope description:TTDSFSDF antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

    Publication: 8757875;
  10. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594672

    Description: epitope description:STTDSFSD antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

Displaying 10 of 1,510,353 results for " "