Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. A monoclonal anti-IgE antibody against an epitope (amino acids 367-376) in the CH3 domain inhibits IgE binding to the low affinity IgE receptor (CD23)...

    ID: 1594401

    Description: epitope description:KGTVNLTWSR antigen name:Immunoglobulin host organism:Mus musculus BALB/c antibody name:mAb 27

    Publication: 2459242;

  2. A mimotope from a solid-phase peptide library induces a measles virus-neutralizing and protective antibody response.

    ID: 1594582

    Description: epitope description:NIIRTKKQ host organism:Mus musculus BALB/c

    Publication: 7494275;

  3. A mimotope from a solid-phase peptide library induces a measles virus-neutralizing and protective antibody response.

    ID: 1594584

    Description: epitope description:QFFRRMDY host organism:Mus musculus BALB/c

    Publication: 7494275;

  4. A mimotope from a solid-phase peptide library induces a measles virus-neutralizing and protective antibody response.

    ID: 1594590

    Description: epitope description:IAAQKPKV host organism:Mus musculus BALB/c

    Publication: 7494275;

  5. A mimotope from a solid-phase peptide library induces a measles virus-neutralizing and protective antibody response.

    ID: 1594602

    Description: epitope description:IAAQKPKV host organism:Mus musculus BALB/c

    Publication: 7494275;

  6. Fine specificity of the genetically controlled immune response to native and recombinant gp15/400 (polyprotein allergen) of Brugia malayi.

    ID: 1594611

    Description: epitope description:IVGDEKMAELKQMKESGLGQEELRAKVDEMLEHVTDEAKKQKIH antigen name:BMA-NPA-1, isoform a host organism:Mus musculus

    Publication: 7622210;

  7. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594651

    Description: epitope description:DAPKTFSMGAKPTGSAAANYTTAVDRPNPA antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

    Publication: 8757875;

  8. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594667

    Description: epitope description:TDSFSDFM antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

    Publication: 8757875;

  9. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594670

    Description: epitope description:TTDSFSDF antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

    Publication: 8757875;

  10. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594672

    Description: epitope description:STTDSFSD antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  11. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594677

    Description: epitope description:ALSTTDSF antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  12. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594681

    Description: epitope description:TALSTTDS antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  13. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594682

    Description: epitope description:TALSTTDS antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

    Publication: 8757875;

  14. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594686

    Description: epitope description:NATALSTT antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  15. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594689

    Description: epitope description:GNATALST antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  16. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594690

    Description: epitope description:GNATALST antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  17. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594693

    Description: epitope description:LGNATALS antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  18. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594704

    Description: epitope description:NPSLLGNA antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  19. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594705

    Description: epitope description:NPSLLGNA antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  20. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594713

    Description: epitope description:TAWNPSLL antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  21. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594714

    Description: epitope description:TAWNPSLL antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  22. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594716

    Description: epitope description:LTAWNPSL antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  23. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594720

    Description: epitope description:NLTAWNPS antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  24. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594723

    Description: epitope description:LNLTAWNP antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  25. Major antigenic determinants of F and ColB2 pili.

    ID: 1584506

    Description: epitope description:AQGQDL antigen name:Plasmid ColB2 protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2409073;

  26. Isolation of antigenically reactive peptide fragments and localization of antigenic regions of alpha-bungarotoxin.

    ID: 1584524

    Description: epitope description:RKM antigen name:Alpha-bungarotoxin isoform A31 host organism:Oryctolagus cuniculus

    Publication: 2458724;

  27. Isolation of antigenically reactive peptide fragments and localization of antigenic regions of alpha-bungarotoxin.

    ID: 1584529

    Description: epitope description:TTATSPISA antigen name:Alpha-bungarotoxin isoform A31 host organism:Oryctolagus cuniculus

    Publication: 2458724;

  28. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584633

    Description: epitope description:LNGKIRAVNLPKVTKEKPTP antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  29. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584637

    Description: epitope description:APNYEKEPTPPTRTPDQAEP antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  30. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584638

    Description: epitope description:PTRTPDQAEPKKPTPPTYET antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  31. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584642

    Description: epitope description:PTPTPDQPEPNKPVEPTYEV antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  32. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584645

    Description: epitope description:QDLPTPPSIPTVHFHYFKLA antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  33. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584647

    Description: epitope description:VQPQVNKEIRNNNDVNIDRT antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  34. A monoclonal antibody that recognizes the predicted tick-borne encephalitis virus E protein fusion sequence blocks fusion.

    ID: 1583852

    Description: epitope description:DRGWGNHCGLFGKGSI antigen name:Genome polyprotein host organism:Mus musculus antibody name:14D2

    Publication: 10416385;

  35. Protective immunogenicity and T lymphocyte specificity of a trivalent hybrid peptide containing NH2-terminal sequences of types 5, 6, and 24 M protein...

    ID: 1583878

    Description: epitope description:RVFPRGTVENP antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2442284;

  36. Protective immunogenicity and T lymphocyte specificity of a trivalent hybrid peptide containing NH2-terminal sequences of types 5, 6, and 24 M protein...

    ID: 1583888

    Description: epitope description:TVTRGTISDPRVFPRGTVENPVATRSQTDTSEKDC host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2442284;

  37. Identification of hepatitis G virus particles in human serum by E2-specific monoclonal antibodies generated by DNA immunization.

    ID: 1583951

    Description: epitope description:LTGGFYEPL antigen name:Pegivirus C protein host organism:Mus musculus BALB/c antibody name:Mc6

    Publication: 9557757;

  38. Epitope mapping of the outer membrane protein P5-homologous fimbrin adhesin of nontypeable Haemophilus influenzae.

    ID: 1584084

    Description: epitope description:SFHDGINNNGAIKKGLSSSNYGYRRNTF antigen name:Outer membrane protein A (3aII*Gd) host organism:Chinchilla lanigera antibody name:Chinc...

    Publication: 10722609;

  39. The major outer membrane protein of Chlamydia trachomatis: critical binding site and conformation determine the specificity of antibody binding to via...

    ID: 1584090

    Description: epitope description:IFDT antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:6Ciii

    Publication: 2473372;

  40. Antigenic structure of the nucleocapsid protein of porcine reproductive and respiratory syndrome virus.

    ID: 1584091

    Description: epitope description:IVQQNQSRGKGPGKKNKKKNPEK antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:SDOW17

    Publication: 9801333;

  41. Epitopes associated with a synthetic hepatitis B surface antigen peptide.

    ID: 1584092

    Description: epitope description:RTCMTTAQGTSMYPSC antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:Y-2, Y-3

    Publication: 6187828;

  42. Epitope mapping of the outer membrane protein P5-homologous fimbrin adhesin of nontypeable Haemophilus influenzae.

    ID: 1584099

    Description: epitope description:GRAKLREAGKPKAKHTNHG antigen name:Outer membrane protein A (3aII*Gd) host organism:Chinchilla lanigera antibody name:Chinchilla ser...

    Publication: 10722609;

  43. Antigenic structure of the nucleocapsid protein of porcine reproductive and respiratory syndrome virus.

    ID: 1584114

    Description: epitope description:IVQQNQSRGKGPGKKNKKKNPEK antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:SDOW17

    Publication: 9801333;

  44. Antigenic structure of the nucleocapsid protein of porcine reproductive and respiratory syndrome virus.

    ID: 1584115

    Description: epitope description:KPHFLLATEDDVRHHFTP antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:EP147, MR40, JP25, 1D2, 2G7, 7C10

    Publication: 9801333;

  45. Synthesis of fusion proteins with multiple copies of an antigenic determinant of foot-and-mouth disease virus.

    ID: 1584117

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2436976;

  46. Synthesis of fusion proteins with multiple copies of an antigenic determinant of foot-and-mouth disease virus.

    ID: 1584121

    Description: epitope description:NRNAVPNLRGDLQVLAQKVARTLPTS antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2436976;

  47. Synthetic vaccines against Friend murine leukaemia virus-induced erythroleukaemia: in vivo and in vitro studies with synthetic oligopeptides and seque...

    ID: 1584142

    Description: epitope description:SPHQVYN antigen name:Envelope glycoprotein host organism:Mus musculus STU

    Publication: 3469323;

  48. Synthetic vaccines against Friend murine leukaemia virus-induced erythroleukaemia: in vivo and in vitro studies with synthetic oligopeptides and seque...

    ID: 1584143

    Description: epitope description:SPHQVYN antigen name:Envelope glycoprotein host organism:Mus musculus STU

    Publication: 3469323;

  49. Synthetic vaccines against Friend murine leukaemia virus-induced erythroleukaemia: in vivo and in vitro studies with synthetic oligopeptides and seque...

    ID: 1584146

    Description: epitope description:SPHQVYN antigen name:Envelope glycoprotein host organism:Mus musculus STU

    Publication: 3469323;

  50. Synthetic vaccines against Friend murine leukaemia virus-induced erythroleukaemia: in vivo and in vitro studies with synthetic oligopeptides and seque...

    ID: 1584148

    Description: epitope description:SHRPREAK antigen name:Envelope glycoprotein host organism:Mus musculus STU

    Publication: 3469323;

  51. Synthetic vaccines against Friend murine leukaemia virus-induced erythroleukaemia: in vivo and in vitro studies with synthetic oligopeptides and seque...

    ID: 1584156

    Description: epitope description:YSQFEKSY antigen name:Envelope glycoprotein host organism:Mus musculus STU

    Publication: 3469323;

  52. The major outer membrane protein of Chlamydia trachomatis: critical binding site and conformation determine the specificity of antibody binding to via...

    ID: 1584161

    Description: epitope description:IFDT antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:10Eii, 6Cii

    Publication: 2473372;

  53. The major outer membrane protein of Chlamydia trachomatis: critical binding site and conformation determine the specificity of antibody binding to via...

    ID: 1584180

    Description: epitope description:IFD antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:CT47

    Publication: 2473372;

  54. The major outer membrane protein of Chlamydia trachomatis: critical binding site and conformation determine the specificity of antibody binding to via...

    ID: 1584187

    Description: epitope description:AIFD antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:CT51A

    Publication: 2473372;

  55. Manipulation of antipeptide immune response by varying the coupling of the peptide with the carrier protein.

    ID: 1584198

    Description: epitope description:GDLQVLAQK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2538727;

  56. Manipulation of antipeptide immune response by varying the coupling of the peptide with the carrier protein.

    ID: 1584199

    Description: epitope description:YKQKIIAP antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 2538727;

  57. A novel antibody against a synthetic NH2-terminal myristoyl glycyl src peptide can detect pp60v-src, the transforming protein of Rous sarcoma virus.

    ID: 1584201

    Description: epitope description:GSSK + MYRI(G1) antigen name:Other Rous sarcoma virus protein host organism:Oryctolagus cuniculus

    Publication: 2552299;

  58. Mutants of the hepatitis B virus surface antigen that define some antigenically essential residues in the immunodominant a region.

    ID: 1584387

    Description: epitope description:P142 antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2693610;

  59. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584649

    Description: epitope description:LVAKQSVVKFQLKTADLPAG antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  60. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584651

    Description: epitope description:RDETTSFVLVDPLPSGYQFN antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  61. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584653

    Description: epitope description:PEATKAASPGFDVAYDNATN antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  62. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584656

    Description: epitope description:LATFNADLTKSVATIYPTVV antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  63. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584669

    Description: epitope description:SVATIYPTVVGQVLNDGATY antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  64. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584670

    Description: epitope description:GQVLNDGATYKNNFSLTVND antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  65. Antigenicity of peptide 19-28 of toxin II from the scorpion Androctonus australis as measured by different solid-phase tests and characterization of s...

    ID: 1584683

    Description: epitope description:NAYANEEATKL host organism:Oryctolagus cuniculus

    Publication: 2448919;

  66. The antibody response to a single antigenic determinant of the tobacco mosaic virus protein: analysis using monoclonal antibodies, mutant proteins and...

    ID: 1584691

    Description: epitope description:TTAETLDATR antigen name:Capsid protein host organism:Mus musculus A/J antibody name:A-11

    Publication: 6203033;

  67. The antibody response to a single antigenic determinant of the tobacco mosaic virus protein: analysis using monoclonal antibodies, mutant proteins and...

    ID: 1584692

    Description: epitope description:TTAETLDATR antigen name:Capsid protein host organism:Mus musculus C3H.SW antibody name:C-10, B-2

    Publication: 6203033;

  68. The antibody response to a single antigenic determinant of the tobacco mosaic virus protein: analysis using monoclonal antibodies, mutant proteins and...

    ID: 1584693

    Description: epitope description:TTAETLDATC antigen name:Capsid protein host organism:Mus musculus C3H.SW antibody name:B-2

    Publication: 6203033;

  69. Surface-exposed epitopes on the major outer-membrane protein of Chlamydia trachomatis defined with peptide antisera.

    ID: 1584699

    Description: epitope description:TTGNAAAPSTL antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus Sandy Half-Lop

    Publication: 2483992;

  70. Surface-exposed epitopes on the major outer-membrane protein of Chlamydia trachomatis defined with peptide antisera.

    ID: 1584722

    Description: epitope description:GLFGNNENQTKV antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus Sandy Half-Lop

    Publication: 2483992;

  71. Surface-exposed epitopes on the major outer-membrane protein of Chlamydia trachomatis defined with peptide antisera.

    ID: 1584731

    Description: epitope description:SFDADTIRIAQP antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus Sandy Half-Lop

    Publication: 2483992;

  72. Surface-exposed epitopes on the major outer-membrane protein of Chlamydia trachomatis defined with peptide antisera.

    ID: 1584734

    Description: epitope description:SAETIFDVTTL antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus Sandy Half-Lop

    Publication: 2483992;

  73. Surface-exposed epitopes on the major outer-membrane protein of Chlamydia trachomatis defined with peptide antisera.

    ID: 1584738

    Description: epitope description:LNPTIAGAGDV antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus Sandy Half-Lop

    Publication: 2483992;

  74. Surface-exposed epitopes on the major outer-membrane protein of Chlamydia trachomatis defined with peptide antisera.

    ID: 1584739

    Description: epitope description:GLFGNNENQTKV antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus Sandy Half-Lop

    Publication: 2483992;

  75. Surface-exposed epitopes on the major outer-membrane protein of Chlamydia trachomatis defined with peptide antisera.

    ID: 1584740

    Description: epitope description:LNPTIAGAGDV antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus Sandy Half-Lop

    Publication: 2483992;

  76. Pollen-related food allergy: cloning and immunological analysis of isoforms and mutants of Mal d 1, the major apple allergen, and Bet v 1, the major b...

    ID: 1584803

    Description: epitope description:S112 antigen name:Mal d 1 host organism:Mus musculus BALB/c

    Publication: 10502033;

  77. Isolation and characterization of monoclonal antibodies against the adenovirus core proteins.

    ID: 1584839

    Description: epitope description:MRRAHHRRRRASHRRMRGG antigen name:Pre-core protein X host organism:Mus musculus BALB/c antibody name:M22, M8, M12, M13, M15, M1

    Publication: 3363867;

  78. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1584858

    Description: epitope description:VKQTLPPS host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  79. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1584861

    Description: epitope description:TLPPSVPN host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  80. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1584867

    Description: epitope description:VPNLRGDL antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  81. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1584871

    Description: epitope description:RGDLQVLA antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  82. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1584873

    Description: epitope description:DLQVLAQK antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  83. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1584874

    Description: epitope description:LQVLAQKV antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  84. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1584876

    Description: epitope description:VLAQKVAR antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  85. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1584880

    Description: epitope description:KVARTPCG host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  86. Pilot study of diagnostic potential of the Mycobacterium tuberculosis recombinant HBHA protein in a vaccinated population in Finland.

    ID: 1584882

    Description: epitope description:ERAEETRTDTRSRVE antigen name:Heparin-binding hemagglutinin host organism:Homo sapiens

    Publication: 18815611;

  87. Pilot study of diagnostic potential of the Mycobacterium tuberculosis recombinant HBHA protein in a vaccinated population in Finland.

    ID: 1584884

    Description: epitope description:RVEESRARLTKLQED antigen name:Heparin-binding hemagglutinin host organism:Homo sapiens

    Publication: 18815611;

  88. Pilot study of diagnostic potential of the Mycobacterium tuberculosis recombinant HBHA protein in a vaccinated population in Finland.

    ID: 1584893

    Description: epitope description:EAALERLRSQQSFEE antigen name:Heparin-binding hemagglutinin host organism:Homo sapiens

    Publication: 18815611;

  89. Pilot study of diagnostic potential of the Mycobacterium tuberculosis recombinant HBHA protein in a vaccinated population in Finland.

    ID: 1584897

    Description: epitope description:DQAVELTQEALGTVA antigen name:Heparin-binding hemagglutinin host organism:Homo sapiens

    Publication: 18815611;

  90. Pilot study of diagnostic potential of the Mycobacterium tuberculosis recombinant HBHA protein in a vaccinated population in Finland.

    ID: 1584905

    Description: epitope description:AAPAKKAAPAKKAAA antigen name:Heparin-binding hemagglutinin host organism:Homo sapiens

    Publication: 18815611;

  91. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1584912

    Description: epitope description:RHKQKIVA antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  92. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1584917

    Description: epitope description:IVAPVKQT antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  93. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1584918

    Description: epitope description:VAPVKQTL antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  94. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1584919

    Description: epitope description:APVKQTLP host organism:Bos taurus

    Publication: 1372368;

  95. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1584920

    Description: epitope description:PVKQTLPP host organism:Bos taurus

    Publication: 1372368;

  96. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1584924

    Description: epitope description:TLPPSVPN host organism:Bos taurus

    Publication: 1372368;

  97. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1584927

    Description: epitope description:PSVPNLRG host organism:Bos taurus

    Publication: 1372368;

  98. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1584928

    Description: epitope description:SVPNLRGD host organism:Bos taurus

    Publication: 1372368;

  99. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1584939

    Description: epitope description:LAQKVART antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  100. Synthetic peptides used to locate the alpha-bungarotoxin binding site and immunogenic regions on alpha subunits of the nicotinic acetylcholine recepto...

    ID: 1585024

    Description: epitope description:YTGKIMWTPPAIFKSY antigen name:Acetylcholine receptor subunit alpha host organism:Rattus norvegicus

    Publication: 2443159;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston