Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587175

    Description: epitope description:AGGKLCPNNL antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  2. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587176

    Description: epitope description:GKLCPNNLCC antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  3. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587178

    Description: epitope description:LCPNNLCCSQ antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  4. Longitudinal analyses of immune responses to Plasmodium falciparum derived peptides corresponding to novel blood stage antigens in coastal Kenya.

    ID: 1587209

    Description: epitope description:QLEEKTKQYNDLQNNMKTIKEQNEHLKNKFQSMGK antigen name:Uncharacterized protein (UniProt:Q8IHV2) host organism:Homo sapiens

    Publication: 18342997;

  5. Longitudinal analyses of immune responses to Plasmodium falciparum derived peptides corresponding to novel blood stage antigens in coastal Kenya.

    ID: 1587210

    Description: epitope description:EKMNMKMEQMDMKMEKIDVNMDQMDVKMEQMDVKMEQMDVKMKRMNK antigen name:Uncharacterized protein PFB0315w host organism:Homo sapiens

    Publication: 18342997;

  6. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587250

    Description: epitope description:PDHNCQSNCK antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  7. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587298

    Description: epitope description:SASNVLATYH antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  8. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587300

    Description: epitope description:SNVLATYHLY antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  9. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587303

    Description: epitope description:VLATYHLYNS antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  10. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587309

    Description: epitope description:LYNSQDHGWD antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston