Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Synthetic peptides used to locate the alpha-bungarotoxin binding site and immunogenic regions on alpha subunits of the nicotinic acetylcholine recepto...

    ID: 1585025

    Description: epitope description:YCEIIVTHFPFDQQNCT antigen name:Acetylcholine receptor subunit alpha host organism:Rattus norvegicus

    Publication: 2443159;

  2. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585028

    Description: epitope description:RHKQKIVA antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  3. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585031

    Description: epitope description:QKIVAPVK antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  4. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585039

    Description: epitope description:KQTLPPSV host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  5. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585045

    Description: epitope description:SVPNLRGD host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  6. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585046

    Description: epitope description:VPNLRGDL antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  7. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585053

    Description: epitope description:DLQVLAQK antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  8. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585056

    Description: epitope description:VLAQKVAR antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  9. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585057

    Description: epitope description:LAQKVART antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  10. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585059

    Description: epitope description:QKVARTPC host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  11. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585072

    Description: epitope description:HKQKIIAP antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  12. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585077

    Description: epitope description:QKIIAPAK antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  13. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585078

    Description: epitope description:QKIIAPAK antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  14. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585086

    Description: epitope description:IAPAKQLL antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  15. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586645

    Description: epitope description:AALTAENTAIKQRNENAKA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  16. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586649

    Description: epitope description:KANADAKAAYEAAVAANNA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  17. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586651

    Description: epitope description:AANNAANAALTAENTAIKK antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  18. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586659

    Description: epitope description:AKLAQYQADLAAVQKTNAA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  19. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586665

    Description: epitope description:LKQYEADLAAVKKANAANE antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  20. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586679

    Description: epitope description:KATYEAAVAANNAKNAALT antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  21. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586680

    Description: epitope description:YQAKLTAYQTELARVQKAN antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  22. Anaplasma marginale major surface protein 2 CD4+-T-cell epitopes are evenly distributed in conserved and hypervariable regions (HVR), whereas linear B...

    ID: 1587098

    Description: epitope description:AGAFARAVEGAEVIEVRAIGSTSVMLNACY antigen name:Major surface protein 2 (MSP2) host organism:Bos taurus

    Publication: 15557669;

  23. Anaplasma marginale major surface protein 2 CD4+-T-cell epitopes are evenly distributed in conserved and hypervariable regions (HVR), whereas linear B...

    ID: 1587100

    Description: epitope description:PYACAGIGGNFVSVVDGHINPKFAYRVKAG antigen name:Major surface protein 2 (MSP2) host organism:Bos taurus

    Publication: 15557669;

  24. Anaplasma marginale major surface protein 2 CD4+-T-cell epitopes are evenly distributed in conserved and hypervariable regions (HVR), whereas linear B...

    ID: 1587109

    Description: epitope description:EGNKDTINLQGMANNINNLSKEDKAV antigen name:Major surface protein 2 (MSP2) host organism:Bos taurus

    Publication: 15557669;

  25. Mapping of immunogenic regions of human T cell leukemia virus type I (HTLV-I) gp46 and gp21 envelope glycoproteins with env-encoded synthetic peptides...

    ID: 1587150

    Description: epitope description:LLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Mus musculus BALB/c antibody name:1C11

    Publication: 2563272;

  26. Mapping of immunogenic regions of human T cell leukemia virus type I (HTLV-I) gp46 and gp21 envelope glycoproteins with env-encoded synthetic peptides...

    ID: 1587152

    Description: epitope description:LLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Mus musculus BALB/c antibody name:1C11

    Publication: 2563272;

  27. Mapping of immunogenic regions of human T cell leukemia virus type I (HTLV-I) gp46 and gp21 envelope glycoproteins with env-encoded synthetic peptides...

    ID: 1587153

    Description: epitope description:LLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 2563272;

  28. Mapping of immunogenic regions of human T cell leukemia virus type I (HTLV-I) gp46 and gp21 envelope glycoproteins with env-encoded synthetic peptides...

    ID: 1587154

    Description: epitope description:LLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Mus musculus BALB/c antibody name:1C11

    Publication: 2563272;

  29. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587168

    Description: epitope description:EQCGRQAGGK antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  30. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587173

    Description: epitope description:RQAGGKLCPN antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  31. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587175

    Description: epitope description:AGGKLCPNNL antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  32. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587176

    Description: epitope description:GKLCPNNLCC antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  33. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587178

    Description: epitope description:LCPNNLCCSQ antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  34. Longitudinal analyses of immune responses to Plasmodium falciparum derived peptides corresponding to novel blood stage antigens in coastal Kenya.

    ID: 1587209

    Description: epitope description:QLEEKTKQYNDLQNNMKTIKEQNEHLKNKFQSMGK antigen name:Uncharacterized protein (UniProt:Q8IHV2) host organism:Homo sapiens

    Publication: 18342997;

  35. Longitudinal analyses of immune responses to Plasmodium falciparum derived peptides corresponding to novel blood stage antigens in coastal Kenya.

    ID: 1587210

    Description: epitope description:EKMNMKMEQMDMKMEKIDVNMDQMDVKMEQMDVKMEQMDVKMKRMNK antigen name:Uncharacterized protein PFB0315w host organism:Homo sapiens

    Publication: 18342997;

  36. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587250

    Description: epitope description:PDHNCQSNCK antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  37. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587298

    Description: epitope description:SASNVLATYH antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  38. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587300

    Description: epitope description:SNVLATYHLY antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  39. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587303

    Description: epitope description:VLATYHLYNS antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  40. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587309

    Description: epitope description:LYNSQDHGWD antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  41. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587331

    Description: epitope description:WDANKPYSWR antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  42. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587335

    Description: epitope description:KPYSWRSKYG antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  43. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587339

    Description: epitope description:WRSKYGWTAF antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  44. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587347

    Description: epitope description:AFCGPVGAHG antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  45. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587356

    Description: epitope description:HGQSSCGKCL antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  46. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587363

    Description: epitope description:CLSVTNTGTG antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  47. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587367

    Description: epitope description:TNTGTGAKTT antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  48. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587372

    Description: epitope description:TGAKTTVRIV antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  49. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587384

    Description: epitope description:CSNGGLDLDV antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  50. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587388

    Description: epitope description:GLDLDVNVFR antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  51. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587389

    Description: epitope description:GLDLDVNVFR antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  52. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587400

    Description: epitope description:FRQLDTDGKG antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  53. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587401

    Description: epitope description:FRQLDTDGKG antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  54. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587407

    Description: epitope description:DGKGYERGHI antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  55. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587409

    Description: epitope description:KGYERGHITV antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  56. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587428

    Description: epitope description:DSFNPLFSVM antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  57. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587430

    Description: epitope description:FNPLFSVMKS antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  58. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587432

    Description: epitope description:PLFSVMKSSV antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  59. Antigenic determinants of the cholera/coli family of enterotoxins.

    ID: 1587648

    Description: epitope description:VEVPGSQHIDSQKKA antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 2446368;

  60. Antigenic determinants of the cholera/coli family of enterotoxins.

    ID: 1587649

    Description: epitope description:KNTLRIAYLTEAKVEKL antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 2446368;

  61. Antigenic determinants of the cholera/coli family of enterotoxins.

    ID: 1587652

    Description: epitope description:VEVPGSQHIDSQ antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 2446368;

  62. Antigenic determinants of the cholera/coli family of enterotoxins.

    ID: 1587664

    Description: epitope description:VEVPGSQHIDSQKKA antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 2446368;

  63. Antigenic determinants of the cholera/coli family of enterotoxins.

    ID: 1587671

    Description: epitope description:VEVPGSQHIDSQ antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 2446368;

  64. Alternative forms of a strain-specific neutralizing antigenic site on the Sindbis virus E2 glycoprotein.

    ID: 1587674

    Description: epitope description:K27 antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:18, 23

    Publication: 2445100;

  65. Analysis of an immunodominant region of infectious bronchitis virus.

    ID: 1587695

    Description: epitope description:TYGKFCIKP antigen name:Spike glycoprotein host organism:Mus musculus antibody name:30.6

    Publication: 2477454;

  66. Analysis of an immunodominant region of infectious bronchitis virus.

    ID: 1587710

    Description: epitope description:PYVTYGKFCIKPDGLVHIIVPEE antigen name:Spike glycoprotein host organism:Gallus gallus

    Publication: 2477454;

  67. Analysis of an immunodominant region of infectious bronchitis virus.

    ID: 1587721

    Description: epitope description:YVTYGKFC antigen name:Spike glycoprotein host organism:Gallus gallus

    Publication: 2477454;

  68. Antibody recognition of a neutralization epitope on the major outer membrane protein of Chlamydia trachomatis.

    ID: 1587749

    Description: epitope description:LQND host organism:Mus musculus BALB/c antibody name:C1.1, C1.2, C1.3, C1.4, C1.5

    Publication: 7513303;

  69. Intranasal treatment with ovalbumin but not the major T cell epitope ovalbumin 323-339 generates interleukin-10 secreting T cells and results in the i...

    ID: 1587755

    Description: epitope description:ISQAVHAAHAEINEAGR antigen name:Gal d 2 host organism:Mus musculus BALB/c

    Publication: 15080822;

  70. Localization of a biologically important epitope on toxic-shock-syndrome toxin-1.

    ID: 1587776

    Description: epitope description:RIKNTDGSIS antigen name:UniProt:D6SEW7 host organism:Oryctolagus cuniculus

    Publication: 2457635;

  71. Identification of the cilium binding epitope of the Mycoplasma hyopneumoniae P97 adhesin.

    ID: 1587780

    Description: epitope description:TKPVAAKPEAAKPEAAKPVAA antigen name:Protein p97 cilium adhesin host organism:Oryctolagus cuniculus antibody name:F1B6

    Publication: 9746576;

  72. Protective antibodies to hepatitis B virus in haemophiliacs.

    ID: 1587790

    Description: epitope description:CMTTAQGTSMYPSCCCTKPTDGNC antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 1826737;

  73. Epitope mapping and functional characterization of monoclonal antibodies specific for the alpha subunit of Escherichia coli RNA polymerase.

    ID: 1587796

    Description: epitope description:RGLSLGMRLEN antigen name:DNA-directed RNA polymerase subunit alpha host organism:Mus musculus SJL antibody name:130B1, 125C6

    Publication: 7522231;

  74. Epitope mapping and functional characterization of monoclonal antibodies specific for the alpha subunit of Escherichia coli RNA polymerase.

    ID: 1587799

    Description: epitope description:ARVEQRTDLDKLVIEMETNGT antigen name:DNA-directed RNA polymerase subunit alpha host organism:Mus musculus SJL antibody name:121C5

    Publication: 7522231;

  75. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587868

    Description: epitope description:NDFPINELILDTDLISKIE antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  76. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587869

    Description: epitope description:ISKIELPSENTESLTDFNV antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  77. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587871

    Description: epitope description:AIKKIFTDENTIFQYLYSQ antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  78. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587873

    Description: epitope description:SLTSSFDDALLFSNKVYSF antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  79. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587874

    Description: epitope description:KVYSFFSMDYIKTANKVVE antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  80. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587875

    Description: epitope description:NKVVEAGLFAGWVKQIVND antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  81. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587881

    Description: epitope description:FLLESYIDNKNKIIKTIDN antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  82. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587884

    Description: epitope description:VNTQFYTIKEGMYKALNYQ antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  83. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587886

    Description: epitope description:YRYNIYSEKEKSNINIDFN antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  84. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587888

    Description: epitope description:INQAIDNINNFINGCSVSY antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  85. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587891

    Description: epitope description:LLNYIDENKLYLIGSAEYE antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  86. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587894

    Description: epitope description:ILIEMFNKYNSELLNNIIL antigen name:Other Clostridium botulinum protein host organism:Homo sapiens

    Publication: 18676021;

  87. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587898

    Description: epitope description:SANSKIRVTQNQNIIFNSV antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  88. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587903

    Description: epitope description:TLIDINGKTKSVFFEYNIR antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  89. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587909

    Description: epitope description:YFSIFNTELSQSNIEERYK antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  90. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587910

    Description: epitope description:EERYKIQSYSEYLKDFWGN antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  91. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587911

    Description: epitope description:DFWGNPLMYNKEYYMFNAG antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  92. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588727

    Description: epitope description:VYQHQKAMKP antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  93. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588730

    Description: epitope description:AMKPWIQPKT antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  94. A major continuous allergenic epitope of bovine beta-lactoglobulin recognized by human IgE binding.

    ID: 1588735

    Description: epitope description:QSAPLRVYVEEL antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 7526967;

  95. A major continuous allergenic epitope of bovine beta-lactoglobulin recognized by human IgE binding.

    ID: 1588737

    Description: epitope description:TDYKKYLLFCME antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 7526967;

  96. A major continuous allergenic epitope of bovine beta-lactoglobulin recognized by human IgE binding.

    ID: 1588752

    Description: epitope description:VTQTMK antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 7526967;

  97. A major continuous allergenic epitope of bovine beta-lactoglobulin recognized by human IgE binding.

    ID: 1588755

    Description: epitope description:GLDIQK antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 7526967;

  98. A major continuous allergenic epitope of bovine beta-lactoglobulin recognized by human IgE binding.

    ID: 1588762

    Description: epitope description:SDISLL antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 7526967;

  99. A major continuous allergenic epitope of bovine beta-lactoglobulin recognized by human IgE binding.

    ID: 1588767

    Description: epitope description:APLRVY antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 7526967;

  100. A major continuous allergenic epitope of bovine beta-lactoglobulin recognized by human IgE binding.

    ID: 1588781

    Description: epitope description:NDECAQ antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 7526967;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston