Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Immunogenicity of a chimeric peptide corresponding to T helper and B cell epitopes of the Chlamydia trachomatis major outer membrane protein.

    ID: 1462705

    Description: epitope description:DVAGLEKDPVAN host organism:Mus musculus DBA/1 antibody name:Anti-AVD1

    Publication: 1370528;

  2. Immunogenicity of a chimeric peptide corresponding to T helper and B cell epitopes of the Chlamydia trachomatis major outer membrane protein.

    ID: 1462707

    Description: epitope description:DVAGLEKDPVAN host organism:Mus musculus DBA/1 antibody name:Anti-AVD1

    Publication: 1370528;

  3. Novel low-molecular-weight synthetic vaccine against foot-and-mouth disease containing a potent B-cell and macrophage activator.

    ID: 1462715

    Description: epitope description:RYNRNAVPNLRGDLQVLAQK antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 2470215;

  4. Mapping epitopes in equine rhinitis A virus VP1 recognized by antibodies elicited in response to infection of the natural host.

    ID: 1462727

    Description: epitope description:LPVGAPTKTTDAWQLKGGGNSVRIQKLAVAGMSPTVVFKI antigen name:polyprotein host organism:Oryctolagus cuniculus antibody name:Rabbit antiser...

    Publication: 12771431;

  5. Mapping epitopes in equine rhinitis A virus VP1 recognized by antibodies elicited in response to infection of the natural host.

    ID: 1462730

    Description: epitope description:RPADKTRHKFPTNINKQ antigen name:polyprotein host organism:Oryctolagus cuniculus antibody name:Rabbit antiserum

    Publication: 12771431;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston