Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585486

    Description: epitope description:CCRHKQKIVAPVKQTLPPSGSGRRGDMGSLAARVVKQPCG host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  2. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585487

    Description: epitope description:CCRHKQKIVAPVKQTLPPSGSGRRGDMGSLAARVVKQPCG host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  3. Strain-specific and common epitopes of gonococcal pili.

    ID: 1585528

    Description: epitope description:SLWARRENGSVKWFC antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6203999;

  4. Strain-specific and common epitopes of gonococcal pili.

    ID: 1585532

    Description: epitope description:SLWARRENGSVKWFC antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6203999;

  5. Strain-specific and common epitopes of gonococcal pili.

    ID: 1585540

    Description: epitope description:PPSDIKGKYVKEVEVK antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6203999;

  6. Strain-specific and common epitopes of gonococcal pili.

    ID: 1585542

    Description: epitope description:EGQKSAVTEY antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6203999;

  7. Strain-specific and common epitopes of gonococcal pili.

    ID: 1585544

    Description: epitope description:PPSDIKGKYVKEVEVK antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6203999;

  8. Strain-specific and common epitopes of gonococcal pili.

    ID: 1585546

    Description: epitope description:EGQKSAVTEY antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6203999;

  9. Strain-specific and common epitopes of gonococcal pili.

    ID: 1585548

    Description: epitope description:PPSDIKGKYVKEVEVK antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6203999;

  10. Characterization of a dominant antigenic determinant of Par o I encoded by recombinant DNA.

    ID: 1585652

    Description: epitope description:GTSSCRLVP antigen name:Par j 1 host organism:Oryctolagus cuniculus antibody name:anti-6a FP

    Publication: 8835131;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston