Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "
  1. Microinjected antibodies against the cytoplasmic domain of vesicular stomatitis virus glycoprotein block its transport to the cell surface.

    ID: 1585732

    Description: epitope description:KRQIYTDIEMNRLGK antigen name:Indiana vesiculovirus protein host organism:Oryctolagus cuniculus

    Publication: 3013626;
  2. The idiotypic characterization of the immune response to a defined epitope of a protein antigen and the specific in vivo suppression of the immune res...

    ID: 1585738

    Description: epitope description:TTAETLDATR antigen name:Capsid protein host organism:Mus musculus CBA

    Publication: 2580019;
  3. Monoclonal antibodies to scorpion toxins. Characterization and molecular mechanisms of neutralization.

    ID: 1585747

    Description: epitope description:K58 antigen name:Alpha-mammal toxin AaH2 host organism:Mus musculus BALB/c antibody name:4C1

    Publication: 2454259;
  4. Identification of a DTH-inducing T-cell epitope on the E2 membrane protein of Semliki Forest virus.

    ID: 1585749

    Description: epitope description:IQDTRNAVRACRIQYHHDPQPVGREKFTIRPHYGKEI antigen name:Structural polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2476243;
  5. Targeting of specific domains of diphtheria toxin by site-directed antibodies.

    ID: 1585824

    Description: epitope description:SESPNK antigen name:Diphtheria toxin (UniProt:H2GU79) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1282534;
  6. Antigenicity of peptide 19-28 of toxin II from the scorpion Androctonus australis as measured by different solid-phase tests and characterization of s...

    ID: 1585902

    Description: epitope description:NAYANEEATKL host organism:Oryctolagus cuniculus

    Publication: 2448919;
  7. Antigenicity of peptide 19-28 of toxin II from the scorpion Androctonus australis as measured by different solid-phase tests and characterization of s...

    ID: 1585905

    Description: epitope description:KLPDHVRTKG antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 2448919;
  8. Production of a recombinant human T-cell leukemia virus type-I trans-activator (tax1) antigen and its utilization for generation of monoclonal antibod...

    ID: 1586153

    Description: epitope description:EPQISPGGLEPPSEKHFRETEV antigen name:Protein Tax-1 host organism:Mus musculus BALB/c antibody name:TAXY-6, TAXY-8

    Publication: 1710610;
  9. Identification of T- and B-cell epitopes associated with a restricted component of the Epstein-Barr virus-induced early antigen complex.

    ID: 1586306

    Description: epitope description:GMLEASEGLDGWIHQ antigen name:Apoptosis regulator BHRF1 host organism:Homo sapiens

    Publication: 7678829;
  10. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586335

    Description: epitope description:AASKTAYEAKLAQYQADLA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

Displaying 10 of 1,510,353 results for " "