Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.
ID: 1481071
Description: epitope description:MSQEKISEIIKDISALKTSCEKLNSQLDELITQ antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:...
Publication: 17653272;Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.
ID: 1481072
Description: epitope description:TSFSKYVRQLEQYFDNFDQDFLSLRQKISDILQ antigen name:Vacuolar ATP synthase catalytic subunit A, putative host organism:Homo sapiens anti...
Publication: 17653272;Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.
ID: 1481075
Description: epitope description:PYLRRAKHNLNNLQGGINNLYSSVNVVYDNLFN antigen name:Uncharacterized J domain-containing protein PF14_0013 host organism:Homo sapiens an...
Publication: 17653272;Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.
ID: 1481080
Description: epitope description:SLLDTLEKSVKGIDENIEKYNKELNVIKQKIE antigen name:Uncharacterized protein PF14_0397 host organism:Homo sapiens antibody name:Human ser...
Publication: 17653272;Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.
ID: 1481084
Description: epitope description:SNKTFEKLNEKLNDIRNDVTNYKNELEEFKN antigen name:Uncharacterized protein MAL7P1.13 host organism:Homo sapiens antibody name:Human sera
Publication: 17653272;