Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "
  1. Identification of type-specific domains within glycoprotein G of herpes simplex virus type 2 (HSV-2) recognized by the majority of patients infected w...

    ID: 1463760

    Description: epitope description:PHGPADAPPGSPAPPPPEHR antigen name:Envelope glycoprotein G host organism:Homo sapiens antibody name:Human sera

    Publication: 10423148;
  2. Immunization of pigs to prevent disease in humans: construction and protective efficacy of a Salmonella enterica serovar Typhimurium live negative-mar...

    ID: 1463853

    Description: epitope description:FAGLKFADY antigen name:Outer membrane porin protein OmpD host organism:Sus scrofa German Landrace

    Publication: 17296750;
  3. Protection of BALB/c mice from respiratory syncytial virus infection by immunization with a synthetic peptide derived from the G glycoprotein.

    ID: 1463884

    Description: epitope description:KRIPNKKPGKKTTTKPTKK antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c

    Publication: 1720589;
  4. Identification of potential B cell epitope determinants by computer techniques, in hemagglutinin-neuraminidase from the porcine rubulavirus La Piedad ...

    ID: 1463901

    Description: epitope description:TTTCFRDTDTGK antigen name:attachment protein host organism:Sus scrofa antibody name:Pig sera

    Publication: 17603842;
  5. Identification of potential B cell epitope determinants by computer techniques, in hemagglutinin-neuraminidase from the porcine rubulavirus La Piedad ...

    ID: 1463924

    Description: epitope description:TTTCFRDTDTGK antigen name:attachment protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 17603842;
  6. Diagnosis and differentiation of HTLV-I and HTLV-II infection by enzyme immunoassays using synthetic peptides.

    ID: 1463958

    Description: epitope description:TSEPTQPPPTSPPLVHDSDLEHVLTPSTSWTTKILKF antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1941526;
  7. Identification of type-specific domains within glycoprotein G of herpes simplex virus type 2 (HSV-2) recognized by the majority of patients infected w...

    ID: 1420203

    Description: epitope description:PEKTPLPVSATAMAPSVDPS antigen name:Envelope glycoprotein G host organism:Mus musculus antibody name:F11

    Publication: 10423148;
  8. Identification of type-specific domains within glycoprotein G of herpes simplex virus type 2 (HSV-2) recognized by the majority of patients infected w...

    ID: 1420213

    Description: epitope description:RAMAGRCRLLLSIGS host organism:Mus musculus antibody name:F11

    Publication: 10423148;
  9. Identification of an epitope on the recombinant bovine PrP that is able to elicit a prominent immune response in wild-type mice.

    ID: 1420229

    Description: epitope description:DYEDRYYRE antigen name:Major prion protein host organism:Mus musculus antibody name:6H4

    Publication: 17884181;
  10. Identification of type-specific domains within glycoprotein G of herpes simplex virus type 2 (HSV-2) recognized by the majority of patients infected w...

    ID: 1420249

    Description: epitope description:PEHRGGPEEFEGAGDGEPPE antigen name:Envelope glycoprotein G host organism:Homo sapiens antibody name:Human sera

    Publication: 10423148;
  11. Identification of type-specific domains within glycoprotein G of herpes simplex virus type 2 (HSV-2) recognized by the majority of patients infected w...

    ID: 1420251

    Description: epitope description:GGPEEFEGAGDGEPPEDDDS antigen name:Envelope glycoprotein G host organism:Homo sapiens antibody name:Human sera

    Publication: 10423148;
  12. Identification of type-specific domains within glycoprotein G of herpes simplex virus type 2 (HSV-2) recognized by the majority of patients infected w...

    ID: 1420252

    Description: epitope description:PEEFEGAGDGEPPEDDDSAT antigen name:Envelope glycoprotein G host organism:Homo sapiens antibody name:Human sera

    Publication: 10423148;
  13. Role of conformational and linear epitopes in the achievement of tolerance in cow's milk allergy.

    ID: 1420336

    Description: epitope description:EEIVPNSVEQ antigen name:Bos d 9 host organism:Homo sapiens antibody name:patient sera

    Publication: 11678861;
  14. Role of conformational and linear epitopes in the achievement of tolerance in cow's milk allergy.

    ID: 1420337

    Description: epitope description:EEIVPNSVEQ antigen name:Bos d 9 host organism:Homo sapiens antibody name:patient sera

    Publication: 11678861;
  15. Role of conformational and linear epitopes in the achievement of tolerance in cow's milk allergy.

    ID: 1420338

    Description: epitope description:PSFSDIPNPI antigen name:Bos d 9 host organism:Homo sapiens antibody name:patient sera

    Publication: 11678861;
  16. Role of conformational and linear epitopes in the achievement of tolerance in cow's milk allergy.

    ID: 1420342

    Description: epitope description:QSKVLPVPQK antigen name:Bos d 11 host organism:Homo sapiens antibody name:patient sera

    Publication: 11678861;
  17. Role of conformational and linear epitopes in the achievement of tolerance in cow's milk allergy.

    ID: 1420343

    Description: epitope description:QSKVLPVPQK antigen name:Bos d 11 host organism:Homo sapiens antibody name:patient sera

    Publication: 11678861;
  18. Role of conformational and linear epitopes in the achievement of tolerance in cow's milk allergy.

    ID: 1420347

    Description: epitope description:YQEPVLGPVR antigen name:Bos d 11 host organism:Homo sapiens antibody name:patient sera

    Publication: 11678861;
  19. A pre-PEXEL histidine-rich protein II erythrocyte binding peptide as a new way for anti-malarial vaccine development.

    ID: 1420348

    Description: epitope description:NNSAFNNNLCSKNAKGLNLN antigen name:Histidine-rich protein III host organism:Aotus nancymaae

    Publication: 17588541;
  20. A pre-PEXEL histidine-rich protein II erythrocyte binding peptide as a new way for anti-malarial vaccine development.

    ID: 1420417

    Description: epitope description:NNSAFNNNLCSKNAKGGNLN host organism:Aotus nancymaae

    Publication: 17588541;
  21. A pre-PEXEL histidine-rich protein II erythrocyte binding peptide as a new way for anti-malarial vaccine development.

    ID: 1420422

    Description: epitope description:NNSAFNNNLCSKNAGGLGLN host organism:Aotus nancymaae

    Publication: 17588541;
  22. A pre-PEXEL histidine-rich protein II erythrocyte binding peptide as a new way for anti-malarial vaccine development.

    ID: 1420426

    Description: epitope description:NNSAFNNNLSSKNAMGLMLN host organism:Aotus nancymaae

    Publication: 17588541;
  23. A pre-PEXEL histidine-rich protein II erythrocyte binding peptide as a new way for anti-malarial vaccine development.

    ID: 1420432

    Description: epitope description:NVSAFNNNLCSKNAMGLVLN host organism:Aotus nancymaae

    Publication: 17588541;
  24. A pre-PEXEL histidine-rich protein II erythrocyte binding peptide as a new way for anti-malarial vaccine development.

    ID: 1420433

    Description: epitope description:NVSAFNNNLCSKNAMGLVLN host organism:Aotus nancymaae

    Publication: 17588541;
  25. A pre-PEXEL histidine-rich protein II erythrocyte binding peptide as a new way for anti-malarial vaccine development.

    ID: 1420437

    Description: epitope description:NISAFIINLSSKNAMGLDLN host organism:Aotus nancymaae

    Publication: 17588541;
  26. Ligand epitope antigen presentation system vaccines against herpes simplex virus.

    ID: 1420569

    Description: epitope description:SSIEFARL antigen name:Envelope glycoprotein B host organism:Mus musculus C57BL/6 antibody name:mouse sera

    Publication: 15569635;
  27. A refined method for molecular typing reveals that co-occurrence of PrP(Sc) types in Creutzfeldt-Jakob disease is not the rule.

    ID: 1420587

    Description: epitope description:NMKH antigen name:Major prion protein host organism:Mus musculus antibody name:MAb 3F4

    Publication: 17893675;
  28. Mapping of the antibody and T cell recognition profiles of the HN domain (residues 449-859) of the heavy chain of botulinum neurotoxin A in two high-r...

    ID: 1420645

    Description: epitope description:TFNFDNEPENISIENLSSD antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15921155;
  29. Mapping of the antibody and T cell recognition profiles of the HN domain (residues 449-859) of the heavy chain of botulinum neurotoxin A in two high-r...

    ID: 1420656

    Description: epitope description:NIERFPNGKKYELDKYTMF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15921155;
  30. Mapping of the antibody and T cell recognition profiles of the HN domain (residues 449-859) of the heavy chain of botulinum neurotoxin A in two high-r...

    ID: 1420667

    Description: epitope description:ALLNPSRVYTFFSSDYVKK antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15921155;
  31. Mapping of the antibody and T cell recognition profiles of the HN domain (residues 449-859) of the heavy chain of botulinum neurotoxin A in two high-r...

    ID: 1420671

    Description: epitope description:DYVKKVNKATEAAMFLGWV antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 15921155;
  32. Mapping of the antibody and T cell recognition profiles of the HN domain (residues 449-859) of the heavy chain of botulinum neurotoxin A in two high-r...

    ID: 1420691

    Description: epitope description:SGAVILLEFIPEIAIPVLG antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15921155;
  33. Mapping of the antibody and T cell recognition profiles of the HN domain (residues 449-859) of the heavy chain of botulinum neurotoxin A in two high-r...

    ID: 1420697

    Description: epitope description:NKVLTVQTIDNALSKRNEK antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 15921155;
  34. Mapping of the antibody and T cell recognition profiles of the HN domain (residues 449-859) of the heavy chain of botulinum neurotoxin A in two high-r...

    ID: 1420715

    Description: epitope description:TKAIINYQYNQYTEEEKNN antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15921155;
  35. Mapping of the antibody and T cell recognition profiles of the HN domain (residues 449-859) of the heavy chain of botulinum neurotoxin A in two high-r...

    ID: 1420730

    Description: epitope description:SMIPYGVKRLEDFDASLKD antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 15921155;
  36. Mapping of the antibody and T cell recognition profiles of the HN domain (residues 449-859) of the heavy chain of botulinum neurotoxin A in two high-r...

    ID: 1420735

    Description: epitope description:ASLKDALLKYIYDNRGTLI antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 15921155;
  37. Recognition of pertussis toxin by antibodies to synthetic peptides.

    ID: 1421004

    Description: epitope description:RQAESSEAMAAWSERAGEA antigen name:Pertussis toxin subunit 1 host organism:Mus musculus

    Publication: 2402246;
  38. Recognition of pertussis toxin by antibodies to synthetic peptides.

    ID: 1421006

    Description: epitope description:PQEQITQHGSPYGRCANK antigen name:Pertussis toxin subunit 2 host organism:Mus musculus

    Publication: 2402246;
  39. Recognition of pertussis toxin by antibodies to synthetic peptides.

    ID: 1421009

    Description: epitope description:RVHVSKEEQYYDYEDATFE antigen name:Pertussis toxin subunit 2 host organism:Mus musculus

    Publication: 2402246;
  40. Identification of epitope on DNA-binding protein expressed in insect cell infected by baculovirus.

    ID: 1421054

    Description: epitope description:TKRKIGDSSSDDNQPKRE antigen name:DBP host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbit sera

    Publication: 16817018;
  41. Production and characterization of human monoclonal antibody recognizing the N-terminal residues of Pseudomonas aeruginosa exotoxin A.

    ID: 1422120

    Description: epitope description:AEEAFDLWNECAKACV antigen name:Exotoxin A host organism:Homo sapiens antibody name:FK-001

    Publication: 1651902;
  42. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422380

    Description: epitope description:REFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Mus musculus antibody name:F3, AK13A2 ...

    Publication: 7506298;
  43. Mapping of the antibody and T cell recognition profiles of the HN domain (residues 449-859) of the heavy chain of botulinum neurotoxin A in two high-r...

    ID: 1422413

    Description: epitope description:AVTLAHELIHAGHR antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 15921155;
  44. Mapping of B-neutralizing and T-helper cell epitopes on the bovine leukemia virus external glycoprotein gp51.

    ID: 1422417

    Description: epitope description:RRRFGARAMV antigen name:gp60 SU host organism:Oryctolagus cuniculus

    Publication: 7688821;
  45. Mapping of B-neutralizing and T-helper cell epitopes on the bovine leukemia virus external glycoprotein gp51.

    ID: 1422420

    Description: epitope description:PDCAICWEPSPPWAPE antigen name:gp60 SU host organism:Oryctolagus cuniculus

    Publication: 7688821;
  46. Mapping of B-neutralizing and T-helper cell epitopes on the bovine leukemia virus external glycoprotein gp51.

    ID: 1422421

    Description: epitope description:PDCAICWEPSPPWAPE antigen name:gp60 SU host organism:Oryctolagus cuniculus

    Publication: 7688821;
  47. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422423

    Description: epitope description:REFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zealand Whit...

    Publication: 7506298;
  48. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422426

    Description: epitope description:REFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zealand Whit...

    Publication: 7506298;
  49. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422431

    Description: epitope description:SELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabb...

    Publication: 7506298;
  50. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422433

    Description: epitope description:SNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cunicu...

    Publication: 7506298;
  51. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422434

    Description: epitope description:SNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cunicu...

    Publication: 7506298;
  52. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422436

    Description: epitope description:REFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zealand Whit...

    Publication: 7506298;
  53. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422437

    Description: epitope description:SELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabb...

    Publication: 7506298;
  54. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422439

    Description: epitope description:SNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/...

    Publication: 7506298;
  55. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423405

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  56. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423414

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  57. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423416

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  58. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423434

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  59. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423435

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  60. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423437

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  61. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423449

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  62. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423455

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  63. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423457

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  64. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423465

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  65. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423466

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  66. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423478

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  67. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423482

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  68. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423490

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  69. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423500

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  70. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423507

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  71. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423509

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  72. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423512

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  73. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423513

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  74. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423516

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  75. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423518

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  76. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423525

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  77. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423531

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  78. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423533

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  79. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423534

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;
  80. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415484

    Description: epitope description:TASVTSPLTTNQTM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  81. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415489

    Description: epitope description:VATHLAGPQSSSAF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  82. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415496

    Description: epitope description:IMGGECPTAEDMVN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  83. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415501

    Description: epitope description:ALLSSLTVTSLLRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  84. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415502

    Description: epitope description:ALLSSLTVTSLLRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  85. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415504

    Description: epitope description:ALLSSLTVTSLLRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  86. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415508

    Description: epitope description:RRLHQWINEDYPSP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  87. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415509

    Description: epitope description:RRLHQWINEDYPSP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  88. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415512

    Description: epitope description:EDYPSP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  89. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415514

    Description: epitope description:EDYPSP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  90. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415516

    Description: epitope description:DWVCSVLADFKAWL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  91. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415517

    Description: epitope description:DWVCSVLADFKAWL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  92. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415531

    Description: epitope description:AITGHVKNGSMRLA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  93. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415536

    Description: epitope description:RLAGPRTCANMWHG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  94. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415544

    Description: epitope description:INEYTTGPSTPCPS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  95. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415546

    Description: epitope description:PNYTRALWRVAANS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  96. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415555

    Description: epitope description:EVRRVGDFHYITGA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  97. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415580

    Description: epitope description:FEPLRAETDDVEPS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  98. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415581

    Description: epitope description:RAETDDVEPSVAAEC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  99. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415585

    Description: epitope description:RAETDDVEPSVAAEC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
  100. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415587

    Description: epitope description:CFKKPPKYPPALPI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

Displaying 100 of 1,510,353 results for " "