Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Peptide mimotopes selected from a random peptide library for diagnosis of Epstein-Barr virus infection.

    ID: 1435606

    Description: epitope description:YTDSSMAVTLMKFASNFLF host organism:Mus musculus antibody name:F1

    Publication: 16517852;

  2. Peptide mimotopes selected from a random peptide library for diagnosis of Epstein-Barr virus infection.

    ID: 1435660

    Description: epitope description:SKLLYNYGACRTGCYMAGR host organism:Mus musculus antibody name:A3

    Publication: 16517852;

  3. Peptide mimotopes selected from a random peptide library for diagnosis of Epstein-Barr virus infection.

    ID: 1435665

    Description: epitope description:VMDECVFSSISVLFCNHMLH host organism:Mus musculus antibody name:A3

    Publication: 16517852;

  4. Species-, serogroup-, and serovar-specific epitopes are juxtaposed in variable sequence region 4 of the major outer membrane proteins of some Chlamydi...

    ID: 1435681

    Description: epitope description:FPLDLT antigen name:Major outer membrane porin host organism:Mus musculus antibody name:F22/4C11, F2/3G8

    Publication: 8698520;

  5. Synthesis and characterization of a protective peptide-based vaccine against Schistosoma mansoni.

    ID: 1435769

    Description: epitope description:GFTTNEPRYNVFAE antigen name:Other Schistosoma mansoni protein host organism:Mus musculus C57BL/6 antibody name:Mouse sera

    Publication: 9712813;

  6. Synthesis and characterization of a protective peptide-based vaccine against Schistosoma mansoni.

    ID: 1435775

    Description: epitope description:GFTTNEPRYNVFAE antigen name:Other Schistosoma mansoni protein host organism:Mus musculus C57BL/6 antibody name:Mouse sera

    Publication: 9712813;

  7. Probing immunogenicity of a T cell epitope by L-alanine and D-amino acid scanning.

    ID: 1436038

    Description: epitope description:CYKKAWRDHRGTI + D-aa(A5) host organism:Mus musculus BALB/c

    Publication: 8544857;

  8. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.

    ID: 1436145

    Description: epitope description:TLDTAH host organism:Equus caballus

    Publication: 10921846;

  9. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.

    ID: 1436153

    Description: epitope description:KQSRRG host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  10. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.

    ID: 1436155

    Description: epitope description:HLFEAP host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  11. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.

    ID: 1436160

    Description: epitope description:PRLKHEQSV host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  12. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.

    ID: 1436163

    Description: epitope description:HRGRAQ host organism:Equus caballus

    Publication: 10921846;

  13. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.

    ID: 1436166

    Description: epitope description:FTILRY host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  14. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.

    ID: 1436171

    Description: epitope description:TSMARYVRHSNYKHM host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  15. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.

    ID: 1436172

    Description: epitope description:MSPILDFPSRKTMKT host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  16. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.

    ID: 1436174

    Description: epitope description:SCNDNKSVPCIVPQL host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  17. Serological specificity of phenolic glycolipid I from Mycobacterium leprae and use in serodiagnosis of leprosy.

    ID: 1436190

    Description: epitope description:phenolic phthiocerol antigen name:phenolic glycolipid-1 host organism:Oryctolagus cuniculus

    Publication: 6193065;

  18. Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus.

    ID: 1436196

    Description: epitope description:CCRHKQKIIAPAKQLLPPSGSGRRGDMGSLAARVVKQPCG host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 2157884;

  19. Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus.

    ID: 1436205

    Description: epitope description:CCRHKQKIIAPAKQLLPPSGSGRRGDMGSLAARVVKQPCG host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 2157884;

  20. Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus.

    ID: 1436206

    Description: epitope description:CCRHKQKIIAPAKQLLPPSGSGRRGDMGSLAARVVKQPCG host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 2157884;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston