Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461427

    Description: epitope description:PSEITSQITTILAST antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV6873 antisera

    Publication: 3476962;

  2. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461430

    Description: epitope description:PSEITSQITTILAST antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV3212 antisera

    Publication: 3476962;

  3. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461435

    Description: epitope description:PSEITSQITTILAST antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:A2 antisera

    Publication: 3476962;

  4. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461442

    Description: epitope description:KNTTPTWLTQNPQLG antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV3212 antisera

    Publication: 3476962;

  5. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461445

    Description: epitope description:AIIQDATSQIKNTTP antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:CH287 antisera

    Publication: 3476962;

  6. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461450

    Description: epitope description:AIIQDATSQIKNTTP antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:CH18537 antisera

    Publication: 3476962;

  7. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461453

    Description: epitope description:AIIQDATSQIKNTTP antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:A2 antisera

    Publication: 3476962;

  8. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461454

    Description: epitope description:SANHKVTPTTAIIQD antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV6873 antisera

    Publication: 3476962;

  9. The hevein domain of the major latex-glove allergen Hev b 6.01 contains dominant T cell reactive sites.

    ID: 1461497

    Description: epitope description:SQWGWCGSTDEYCSPDHNCQ antigen name:Hev b 6 host organism:Homo sapiens antibody name:patient sera

    Publication: 15080815;

  10. The hevein domain of the major latex-glove allergen Hev b 6.01 contains dominant T cell reactive sites.

    ID: 1461498

    Description: epitope description:DEYCSPDHNCQSNCKDSGEG antigen name:Hev b 6 host organism:Homo sapiens antibody name:patient sera

    Publication: 15080815;

  11. The hevein domain of the major latex-glove allergen Hev b 6.01 contains dominant T cell reactive sites.

    ID: 1461501

    Description: epitope description:NVLATYHLYNSQDHGWDLNA antigen name:Hev b 6 host organism:Homo sapiens antibody name:patient sera

    Publication: 15080815;

  12. The hevein domain of the major latex-glove allergen Hev b 6.01 contains dominant T cell reactive sites.

    ID: 1461502

    Description: epitope description:NSQDHGWDLNAASAYCSTWD antigen name:Hev b 6 host organism:Homo sapiens antibody name:patient sera

    Publication: 15080815;

  13. The hevein domain of the major latex-glove allergen Hev b 6.01 contains dominant T cell reactive sites.

    ID: 1461503

    Description: epitope description:NAASAYCSTWDANKPYSWRS antigen name:Hev b 6 host organism:Homo sapiens antibody name:patient sera

    Publication: 15080815;

  14. Characterization of two antigenic sites recognized by neutralizing monoclonal antibodies directed against the fusion glycoprotein of human respiratory...

    ID: 1461542

    Description: epitope description:S190, L258, K272 antigen name:Fusion glycoprotein F0 host organism:Mus musculus antibody name:7C2

    Publication: 1383404;

  15. Serologically defined linear epitopes in the E2 envelope glycoprotein of Semliki Forest virus.

    ID: 1461608

    Description: epitope description:PVAIEAVRSEATDGMLKIQF antigen name:Structural polyprotein host organism:Mus musculus ICR antibody name:Mouse hyperimmune AF

    Publication: 1696808;

  16. Serologically defined linear epitopes in the E2 envelope glycoprotein of Semliki Forest virus.

    ID: 1461612

    Description: epitope description:CFVHGTMGHFILAKCPPGEF antigen name:Structural polyprotein host organism:Mus musculus ICR antibody name:Mouse hyperimmune AF

    Publication: 1696808;

  17. Serologically defined linear epitopes in the E2 envelope glycoprotein of Semliki Forest virus.

    ID: 1461619

    Description: epitope description:KVKYNCTCGTGNVGTTNSDM antigen name:Structural polyprotein host organism:Mus musculus ICR antibody name:Mouse hyperimmune AF

    Publication: 1696808;

  18. Serologically defined linear epitopes in the E2 envelope glycoprotein of Semliki Forest virus.

    ID: 1461620

    Description: epitope description:TNSDMTINTCLIEQCHVSVT antigen name:Structural polyprotein host organism:Mus musculus ICR antibody name:Mouse hyperimmune AF

    Publication: 1696808;

  19. Serologically defined linear epitopes in the E2 envelope glycoprotein of Semliki Forest virus.

    ID: 1461622

    Description: epitope description:FVPRADEPARKGKVHIPFPL antigen name:Structural polyprotein host organism:Mus musculus ICR antibody name:Mouse hyperimmune AF

    Publication: 1696808;

  20. Serologically defined linear epitopes in the E2 envelope glycoprotein of Semliki Forest virus.

    ID: 1461623

    Description: epitope description:IPFPLDNITCRVPMAREPTV antigen name:Structural polyprotein host organism:Mus musculus ICR antibody name:Mouse hyperimmune AF

    Publication: 1696808;

  21. Serologically defined linear epitopes in the E2 envelope glycoprotein of Semliki Forest virus.

    ID: 1461624

    Description: epitope description:REPTVIHGKREVTLHLHPDH antigen name:Structural polyprotein host organism:Mus musculus ICR antibody name:Mouse hyperimmune AF

    Publication: 1696808;

  22. Serologically defined linear epitopes in the E2 envelope glycoprotein of Semliki Forest virus.

    ID: 1461627

    Description: epitope description:RTIPVPVDGMEYHWGNNDPV antigen name:Structural polyprotein host organism:Mus musculus ICR antibody name:Mouse hyperimmune AF

    Publication: 1696808;

  23. Serologically defined linear epitopes in the E2 envelope glycoprotein of Semliki Forest virus.

    ID: 1461631

    Description: epitope description:LALISIFASCYMLVAARSKC antigen name:Structural polyprotein host organism:Mus musculus ICR antibody name:Mouse hyperimmune AF

    Publication: 1696808;

  24. Identification of synthetic vaccine candidates against SARS CoV infection.

    ID: 1462474

    Description: epitope description:DSFKEELDKYFKNHTSPDVDLGDISGINASVV antigen name:Spike glycoprotein host organism:Cavia porcellus

    Publication: 17506989;

  25. Identification of synthetic vaccine candidates against SARS CoV infection.

    ID: 1462483

    Description: epitope description:GNYNYKYRYLRHGKLRPFER antigen name:Spike glycoprotein host organism:Cavia porcellus

    Publication: 17506989;

  26. Immunogenicity of a chimeric peptide corresponding to T helper and B cell epitopes of the Chlamydia trachomatis major outer membrane protein.

    ID: 1462513

    Description: epitope description:GAAPTTSDVAGLEKDPVANVA host organism:Mus musculus BALB/c antibody name:Anti-AVD1

    Publication: 1370528;

  27. Immunogenicity of a chimeric peptide corresponding to T helper and B cell epitopes of the Chlamydia trachomatis major outer membrane protein.

    ID: 1462521

    Description: epitope description:GAAPTTSDVAGLEKDPVANVA host organism:Mus musculus SJL antibody name:Anti-AVD1

    Publication: 1370528;

  28. Immunogenicity of a chimeric peptide corresponding to T helper and B cell epitopes of the Chlamydia trachomatis major outer membrane protein.

    ID: 1462552

    Description: epitope description:GAAPTTSDVAGLEKDPVANVA host organism:Mus musculus C57BL/10 antibody name:Anti-A8-VD1

    Publication: 1370528;

  29. Immunogenicity of a chimeric peptide corresponding to T helper and B cell epitopes of the Chlamydia trachomatis major outer membrane protein.

    ID: 1462553

    Description: epitope description:GAAPTTSDVAGLEKDPVANVA host organism:Mus musculus BALB/c antibody name:Anti-A8-VD1

    Publication: 1370528;

  30. Association of the outcome of renal transplantation with antibody response to cytomegalovirus strain-specific glycoprotein H epitopes.

    ID: 1462557

    Description: epitope description:LDPHAFHLLL antigen name:Envelope glycoprotein H host organism:Homo sapiens

    Publication: 17554702;

  31. Association of the outcome of renal transplantation with antibody response to cytomegalovirus strain-specific glycoprotein H epitopes.

    ID: 1462558

    Description: epitope description:LDKAFHLLL antigen name:Envelope glycoprotein H host organism:Homo sapiens

    Publication: 17554702;

  32. Immunogenicity of a chimeric peptide corresponding to T helper and B cell epitopes of the Chlamydia trachomatis major outer membrane protein.

    ID: 1462570

    Description: epitope description:GAAPTTSDVAGLEKDPVANVA host organism:Mus musculus A.SW antibody name:Anti-A8-VD1

    Publication: 1370528;

  33. Immunogenicity of a chimeric peptide corresponding to T helper and B cell epitopes of the Chlamydia trachomatis major outer membrane protein.

    ID: 1462585

    Description: epitope description:GAAPTTSDVAGLEKDPVANVA host organism:Mus musculus A.SW antibody name:Anti-AVD1

    Publication: 1370528;

  34. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.

    ID: 1462597

    Description: epitope description:KQPQPRLRVKTPPPVTVP antigen name:Envelope glycoprotein E host organism:Equus caballus

    Publication: 10921846;

  35. Immunogenicity of a chimeric peptide corresponding to T helper and B cell epitopes of the Chlamydia trachomatis major outer membrane protein.

    ID: 1462671

    Description: epitope description:TTSDVAGLEKDPVAN host organism:Mus musculus CBA antibody name:Anti-AVD1

    Publication: 1370528;

  36. Immunogenicity of a chimeric peptide corresponding to T helper and B cell epitopes of the Chlamydia trachomatis major outer membrane protein.

    ID: 1462705

    Description: epitope description:DVAGLEKDPVAN host organism:Mus musculus DBA/1 antibody name:Anti-AVD1

    Publication: 1370528;

  37. Immunogenicity of a chimeric peptide corresponding to T helper and B cell epitopes of the Chlamydia trachomatis major outer membrane protein.

    ID: 1462707

    Description: epitope description:DVAGLEKDPVAN host organism:Mus musculus DBA/1 antibody name:Anti-AVD1

    Publication: 1370528;

  38. Novel low-molecular-weight synthetic vaccine against foot-and-mouth disease containing a potent B-cell and macrophage activator.

    ID: 1462715

    Description: epitope description:RYNRNAVPNLRGDLQVLAQK antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 2470215;

  39. Mapping epitopes in equine rhinitis A virus VP1 recognized by antibodies elicited in response to infection of the natural host.

    ID: 1462727

    Description: epitope description:LPVGAPTKTTDAWQLKGGGNSVRIQKLAVAGMSPTVVFKI antigen name:polyprotein host organism:Oryctolagus cuniculus antibody name:Rabbit antiser...

    Publication: 12771431;

  40. Mapping epitopes in equine rhinitis A virus VP1 recognized by antibodies elicited in response to infection of the natural host.

    ID: 1462730

    Description: epitope description:RPADKTRHKFPTNINKQ antigen name:polyprotein host organism:Oryctolagus cuniculus antibody name:Rabbit antiserum

    Publication: 12771431;

  41. Proliferative lymphocyte responses to foot-and-mouth disease virus and three FMDV peptides after vaccination or immunization with these peptides in ca...

    ID: 1462785

    Description: epitope description:SRRGDLGSLATRVATQ antigen name:Polyprotein host organism:Bos taurus Friesian

    Publication: 1349300;

  42. Humoral immune response to the E7 protein of bovine papillomavirus type 4 and identification of B-cell epitopes.

    ID: 1462818

    Description: epitope description:LCAACSKQVFCNRRPERNGP antigen name:Protein E7 host organism:Bos taurus antibody name:Bovine Serum

    Publication: 7510442;

  43. IgA antibodies of coeliac disease patients recognise a dominant T cell epitope of A-gliadin.

    ID: 1462896

    Description: epitope description:QLQPFPQP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15306584;

  44. IgA antibodies of coeliac disease patients recognise a dominant T cell epitope of A-gliadin.

    ID: 1462901

    Description: epitope description:PQPELPYP antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 15306584;

  45. Preparation and characterization of monoclonal antibody against abalone allergen tropomyosin.

    ID: 1462905

    Description: epitope description:L99, K149, R160 antigen name:Tropomyosin host organism:Mus musculus BALB/c antibody name:MAb AE9F9

    Publication: 15684662;

  46. Sequence analysis of Pasteurella multocida major outer membrane protein (OmpH) and application of synthetic peptides in vaccination of chickens agains...

    ID: 1462911

    Description: epitope description:SKNVPVQVKDQQGEVVREYEVEKLGNNVHV antigen name:Other Pasteurella multocida protein host organism:Gallus gallus antibody name:Chicken ...

    Publication: 10067687;

  47. Sequence analysis of Pasteurella multocida major outer membrane protein (OmpH) and application of synthetic peptides in vaccination of chickens agains...

    ID: 1462912

    Description: epitope description:KYVKQEVEQNPPAAQKVFKDEK antigen name:Other Pasteurella multocida protein host organism:Gallus gallus antibody name:Chicken sera

    Publication: 10067687;

  48. Ability of synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa to afford protection against P. aeruginosa i...

    ID: 1462956

    Description: epitope description:TDAYNQKLSERRAN antigen name:Outer membrane porin F host organism:Mus musculus ICR

    Publication: 8701588;

  49. Ability of synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa to afford protection against P. aeruginosa i...

    ID: 1462961

    Description: epitope description:NATAEGRAINRRVE antigen name:Outer membrane porin F host organism:Mus musculus ICR

    Publication: 8701588;

  50. A recombinant subunit vaccine based on the insertion of 27 amino acids from Omp31 to the N-terminus of BLS induced a similar degree of protection agai...

    ID: 1462969

    Description: epitope description:NAGYAGGKFKHPFSSFDKEDNEQVSGS antigen name:31 kDa outer-membrane immunogenic protein host organism:Mus musculus BALB/c antibody name...

    Publication: 17442465;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston