Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

ID: 1472765

Description: epitope description:VDQHNATEICRLIKLC antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White

Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

ID: 1472768

Description: epitope description:SFDVPSKQPTIDIDL antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Mus musculus Swiss

Two novel types of O-glycans on the mugwort pollen allergen Art v 1 and their role in antibody binding.

ID: 1472790

Description: epitope description:alpha-L-arabinofuranose antigen name:Art v 1 host organism:Homo sapiens

Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

ID: 1472799

Description: epitope description:CDICTNTMDVIKKML antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White

Direct evaluation of the immunodominance of a major antigenic site of foot-and-mouth disease virus in a natural host.

ID: 1472838

Description: epitope description:YTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Sus scrofa Landrace X Large White antibody name:Swine sera

Direct evaluation of the immunodominance of a major antigenic site of foot-and-mouth disease virus in a natural host.

ID: 1472879

Description: epitope description:ASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:mAb SD6

Synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa that elicit antibodies reactive with whole cells of het...

ID: 1472892

Description: epitope description:DKCPDTPANVTVDAN antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

Synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa that elicit antibodies reactive with whole cells of het...

ID: 1472893

Description: epitope description:KFDFDKSKVKENSY antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

Mutational analysis of the IgE-binding epitopes of P34/Gly m Bd 30K.

ID: 1472923

Description: epitope description:PQEFSKKTYQ antigen name:Hydrophobic seed protein host organism:Homo sapiens

Synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa that elicit antibodies reactive with whole cells of het...

ID: 1472927

Description: epitope description:RGTYETGNKKVHGN antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

Synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa that elicit antibodies reactive with whole cells of het...

ID: 1472930

Description: epitope description:SDSDNDGVCDNVDK antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

Synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa that elicit antibodies reactive with whole cells of het...

ID: 1472937

Description: epitope description:NATAEGRAINRRVE antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

Direct evaluation of the immunodominance of a major antigenic site of foot-and-mouth disease virus in a natural host.

ID: 1472943

Description: epitope description:ASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Sus scrofa Landrace X Large White

A globotriaosylceramide (Gb3Cer) mimic peptide isolated from phage display library expressed strong neutralization to Shiga toxins.

ID: 1472944

Description: epitope description:GGPIPTIPRPTL host organism:Oryctolagus cuniculus antibody name:anti-Gb3

A globotriaosylceramide (Gb3Cer) mimic peptide isolated from phage display library expressed strong neutralization to Shiga toxins.

ID: 1472949

Description: epitope description:FQWSWYTPPRPS host organism:Oryctolagus cuniculus antibody name:anti-Gb3

A globotriaosylceramide (Gb3Cer) mimic peptide isolated from phage display library expressed strong neutralization to Shiga toxins.

ID: 1472951

Description: epitope description:EQWPWSLLPIHY host organism:Oryctolagus cuniculus antibody name:anti-Gb3

A globotriaosylceramide (Gb3Cer) mimic peptide isolated from phage display library expressed strong neutralization to Shiga toxins.

ID: 1472957

Description: epitope description:WHWTWLSEYPPP host organism:Oryctolagus cuniculus antibody name:anti-Gb3

Conjugates of synthetic cyclic peptides elicit bactericidal antibodies against a conformational epitope on a class 1 outer membrane protein of Neisser...

ID: 1472986

Description: epitope description:YTKDTNNNL antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c antibody name:Mouse sera

Characterization of monoclonal antibodies generated against Norwalk virus GII capsid protein expressed in Escherichia coli.

ID: 1472995

Description: epitope description:EAKVDTTAGRFTPKLGSLEISTESSDFDQNQPTRFTPVGIG antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:MAb 4D2

Analysis of the immune response against mixotope peptide libraries from a main antigenic site of foot-and-mouth disease virus.

ID: 1473011

Description: epitope description:TTYTASARGDLAHPTTTHARHL host organism:Cavia porcellus Duncan-Hartley antibody name:Guinea pig sera