Sequence analysis of Pasteurella multocida major outer membrane protein (OmpH) and application of synthetic peptides in vaccination of chickens agains...

ID: 1462911

Description: epitope description:SKNVPVQVKDQQGEVVREYEVEKLGNNVHV antigen name:Other Pasteurella multocida protein host organism:Gallus gallus antibody name:Chicken ...

Sequence analysis of Pasteurella multocida major outer membrane protein (OmpH) and application of synthetic peptides in vaccination of chickens agains...

ID: 1462912

Description: epitope description:KYVKQEVEQNPPAAQKVFKDEK antigen name:Other Pasteurella multocida protein host organism:Gallus gallus antibody name:Chicken sera

Ability of synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa to afford protection against P. aeruginosa i...

ID: 1462956

Description: epitope description:TDAYNQKLSERRAN antigen name:Outer membrane porin F host organism:Mus musculus ICR

Ability of synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa to afford protection against P. aeruginosa i...

ID: 1462961

Description: epitope description:NATAEGRAINRRVE antigen name:Outer membrane porin F host organism:Mus musculus ICR

A recombinant subunit vaccine based on the insertion of 27 amino acids from Omp31 to the N-terminus of BLS induced a similar degree of protection agai...

ID: 1462969

Description: epitope description:NAGYAGGKFKHPFSSFDKEDNEQVSGS antigen name:31 kDa outer-membrane immunogenic protein host organism:Mus musculus BALB/c antibody name...