Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481823

    Description: epitope description:KKRNVEEELHSLRKNYNIINEEIEEIT antigen name:RING finger protein PFF0165c host organism:Mus musculus antibody name:Mouse sera

    Publication: 17653272;

  2. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481825

    Description: epitope description:KIQIEEIKKETNQINKDIDHIEMNIINLKKKIEF antigen name:Serine--tRNA ligase, cytoplasmic host organism:Mus musculus antibody name:Mouse se...

    Publication: 17653272;

  3. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481836

    Description: epitope description:CVCRSCRTMSLQKTVEKLFDELDKDKSGKISCAELKSALQSCSAEPLDDDH antigen name:Immunogenic protein host organism:Mus musculus Outbred

    Publication: 17403055;

  4. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481837

    Description: epitope description:ELKSALQSCSAEPLDDDHVKAFLDKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Mus musculus Outbred

    Publication: 17403055;

  5. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481838

    Description: epitope description:ELDKDKSGKISCAELKSALQ antigen name:Immunogenic protein host organism:Mus musculus Outbred

    Publication: 17403055;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston