Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481845

    Description: epitope description:AELKSALQSCSAEPLDDDHVKAFLDK antigen name:Immunogenic protein host organism:Homo sapiens

    Publication: 17403055;

  2. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481846

    Description: epitope description:HVKAFLDKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Homo sapiens

    Publication: 17403055;

  3. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481860

    Description: epitope description:ELKSALQSCSAEPLDDDHVKAFLDKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Homo sapiens

    Publication: 17403055;

  4. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481866

    Description: epitope description:CVCRSCRTMSLQKTVEKLFDELDKDKSGKISCAELKSALQ antigen name:Immunogenic protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17403055;

  5. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481875

    Description: epitope description:DKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Mus musculus BALB/c

    Publication: 17403055;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston