Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

ID: 1481876

Description: epitope description:ELDKDKSGKISCAELKSALQSCSAEPLDDDH antigen name:Immunogenic protein host organism:Mus musculus BALB/c

Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

ID: 1481879

Description: epitope description:ELKSALQSCSAEPLDDDHVKAFLDKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Mus musculus BALB/c

An epitope located at the C terminus of isolated VP1 of foot-and-mouth disease virus type O induces neutralizing activity but poor protection.

ID: 1481882

Description: epitope description:GDLQVLA antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:anti-146-152

An epitope located at the C terminus of isolated VP1 of foot-and-mouth disease virus type O induces neutralizing activity but poor protection.

ID: 1481908

Description: epitope description:RHKQKIVAPVK antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:MCA a-A

Immunogenicity of variable regions of the surface envelope glycoprotein of HTLV type I and identification of new major epitopes in the 239-261 region.

ID: 1481930

Description: epitope description:VLYSPNVSVPSSSSTPLLYPSLA antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens