Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Analysis of neutralizing epitopes on foot-and-mouth disease virus.

    ID: 1482056

    Description: epitope description:LRGDLQVLAQKVARTL antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:anti-peptide A

    Publication: 2835507;

  2. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475076

    Description: epitope description:IANTTSFNGKQLLSGNFINQEFQIGASSNQ antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  3. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475077

    Description: epitope description:IANTTSFNGKQLLSGNFINQEFQIGASSNQ antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  4. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475089

    Description: epitope description:ASSNQTVKATIGATQSSKIGLTRFETGGRI antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  5. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475097

    Description: epitope description:TGGRISSSGEVQFTLKNYNGIDDFQFQKVV antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston