Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582636

    Description: epitope description:VAGLQN host organism:Mus musculus C57BL/10

    Publication: 7518628;

  2. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582637

    Description: epitope description:AGLQND host organism:Mus musculus C57BL/10

    Publication: 7518628;

  3. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582644

    Description: epitope description:TTNVAR host organism:Mus musculus C57BL/10

    Publication: 7518628;

  4. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582646

    Description: epitope description:SATAIF antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  5. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582648

    Description: epitope description:TAIFDT antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  6. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582651

    Description: epitope description:FDTTTL antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  7. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582658

    Description: epitope description:PTIAGA antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  8. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582660

    Description: epitope description:IAGAGD antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  9. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582661

    Description: epitope description:AGAGDV antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  10. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582668

    Description: epitope description:ASAEGQ antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  11. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582670

    Description: epitope description:AEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  12. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582672

    Description: epitope description:CSATAIFDTTTLNPTIAGAGDVKASACAAPTTSDVAGLQNDPTTNVA host organism:Mus musculus C57BL/10

    Publication: 7518628;

  13. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582676

    Description: epitope description:CSATAIFDTTTLNPTIAGAGDVKASACAAPTTSDVAGLQNDPTTNVA host organism:Mus musculus C57BL/10

    Publication: 7518628;

  14. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582680

    Description: epitope description:CSATAIFDTTTLNPTIAGAGDVKASACAAPTTSDVAGLQNDPTTNVA host organism:Mus musculus C57BL/10

    Publication: 7518628;

  15. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582683

    Description: epitope description:CSATAIFDTTTLNPTIAGAGDVKASACAAPTTSDVAGLQNDPTTNVA host organism:Mus musculus C57BL/10

    Publication: 7518628;

  16. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582696

    Description: epitope description:CSATAIFDTTTLNPTIAGAGDVKASACAAPTTSDVAGLQNDPTTNVA host organism:Mus musculus C57BL/10

    Publication: 7518628;

  17. Epitope mapping of antibodies recognising the N-terminal domain of simian virus large tumour antigen.

    ID: 1582770

    Description: epitope description:TEIPTYGTDEWEQWW antigen name:Macaca mulatta polyomavirus 1 protein host organism:Mus musculus BALB/c antibody name:pAb 211, pAb 22...

    Publication: 9705560;

  18. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583400

    Description: epitope description:SDSNLKDLTF antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  19. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583422

    Description: epitope description:EKVTIQNWFR antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  20. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583425

    Description: epitope description:TIQNWFREAD antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  21. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583431

    Description: epitope description:READFAKEVP antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  22. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583432

    Description: epitope description:READFAKEVP antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  23. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583445

    Description: epitope description:KATKDEKIEE antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  24. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583459

    Description: epitope description:GERITSKQVD antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  25. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583467

    Description: epitope description:DDLIAKGNGK antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  26. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583471

    Description: epitope description:IAKGNGKITQ antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  27. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583472

    Description: epitope description:IAKGNGKITQ antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  28. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583474

    Description: epitope description:GNGKITQDEL antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  29. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583477

    Description: epitope description:KITQDELSKV antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  30. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583478

    Description: epitope description:KITQDELSKV antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  31. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583481

    Description: epitope description:QDELSKVVDN antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  32. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583484

    Description: epitope description:LSKVVDNYEL antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  33. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583501

    Description: epitope description:NSLDKLISSV antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  34. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583509

    Description: epitope description:VSAFTSSNDS antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  35. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583518

    Description: epitope description:SRNVLVAPTS antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  36. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583521

    Description: epitope description:VLVAPTSMLD antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  37. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583523

    Description: epitope description:VLVAPTSMLD antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  38. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583526

    Description: epitope description:APTSMLDQSL antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  39. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583535

    Description: epitope description:LSSLQFARAA antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  40. Accessibility of three continuous epitopes in tomato bushy stunt virus.

    ID: 1583571

    Description: epitope description:GALRNYIGESSPA antigen name:Capsid protein host organism:Oryctolagus cuniculus

    Publication: 3207502;

  41. Accessibility of three continuous epitopes in tomato bushy stunt virus.

    ID: 1583573

    Description: epitope description:GALRNYIGESSPA antigen name:Capsid protein host organism:Oryctolagus cuniculus

    Publication: 3207502;

  42. Characterization of dengue virus complex-specific neutralizing epitopes on envelope protein domain III of dengue 2 virus.

    ID: 1583643

    Description: epitope description:K310, P332, W391 antigen name:Genome polyprotein host organism:Mus musculus antibody name:MDVP-55A

    Publication: 18562544;

  43. Characterization of dengue virus complex-specific neutralizing epitopes on envelope protein domain III of dengue 2 virus.

    ID: 1583644

    Description: epitope description:K310, P332, W391 antigen name:Genome polyprotein host organism:Mus musculus antibody name:MDVP-55A

    Publication: 18562544;

  44. Immunization with a peptide having both T cell and conformationally restricted B cell epitopes elicits neutralizing antisera against a snake neurotoxi...

    ID: 1583650

    Description: epitope description:CYKKVWRDHRGTIIERGC antigen name:Naja nigricollis (black-necked spitting cobra) protein host organism:Mus musculus BALB/c

    Publication: 1701784;

  45. Immunization with a peptide having both T cell and conformationally restricted B cell epitopes elicits neutralizing antisera against a snake neurotoxi...

    ID: 1583654

    Description: epitope description:CYKKVWRDHRGTIIERGC antigen name:Naja nigricollis (black-necked spitting cobra) protein host organism:Mus musculus BALB/c

    Publication: 1701784;

  46. Topology of outer membrane pore protein PhoE of Escherichia coli. Identification of cell surface-exposed amino acids with the aid of monoclonal antibo...

    ID: 1583721

    Description: epitope description:R222, G296 antigen name:Outer membrane pore protein E host organism:Mus musculus BALB/c antibody name:PP1-2, PP1-3, PP1-5, PP3-1, ...

    Publication: 3528150;

  47. The orientation of the adenovirus fiber and its anchor domain identified through molecular mimicry.

    ID: 1583773

    Description: epitope description:YNKRFPGFVSP antigen name:Other Human mastadenovirus C protein host organism:Oryctolagus cuniculus

    Publication: 2462763;

  48. A novel approach for localization of the continuous protein antigenic sites by comprehensive synthetic surface scanning: antibody and T-cell activity ...

    ID: 1583788

    Description: epitope description:GTLVKTITDDQIEV antigen name:Hemagglutinin host organism:Mus musculus

    Publication: 6085322;

  49. A novel approach for localization of the continuous protein antigenic sites by comprehensive synthetic surface scanning: antibody and T-cell activity ...

    ID: 1583804

    Description: epitope description:HHPSTNQEQTSLYVQAS antigen name:Hemagglutinin host organism:Homo sapiens

    Publication: 6085322;

  50. A novel approach for localization of the continuous protein antigenic sites by comprehensive synthetic surface scanning: antibody and T-cell activity ...

    ID: 1583810

    Description: epitope description:APIDTGISEGITPNGSI host organism:Mus musculus

    Publication: 6085322;

  51. A novel approach for localization of the continuous protein antigenic sites by comprehensive synthetic surface scanning: antibody and T-cell activity ...

    ID: 1583812

    Description: epitope description:ITGAGPKYVKQNTLK host organism:Mus musculus

    Publication: 6085322;

  52. A novel approach for localization of the continuous protein antigenic sites by comprehensive synthetic surface scanning: antibody and T-cell activity ...

    ID: 1583820

    Description: epitope description:GTLVKTITDDQIEV antigen name:Hemagglutinin host organism:Mus musculus

    Publication: 6085322;

  53. A novel approach for localization of the continuous protein antigenic sites by comprehensive synthetic surface scanning: antibody and T-cell activity ...

    ID: 1583833

    Description: epitope description:DKLYIWGVHHPSTN antigen name:Hemagglutinin host organism:Mus musculus

    Publication: 6085322;

  54. A novel approach for localization of the continuous protein antigenic sites by comprehensive synthetic surface scanning: antibody and T-cell activity ...

    ID: 1583840

    Description: epitope description:APIDTGISEGITPNGSI host organism:Mus musculus

    Publication: 6085322;

  55. A monoclonal antibody that recognizes the predicted tick-borne encephalitis virus E protein fusion sequence blocks fusion.

    ID: 1583841

    Description: epitope description:DRGWGNHCGLFGKGSI antigen name:Genome polyprotein host organism:Mus musculus antibody name:14D2

    Publication: 10416385;

  56. A novel approach for localization of the continuous protein antigenic sites by comprehensive synthetic surface scanning: antibody and T-cell activity ...

    ID: 1583842

    Description: epitope description:ITGAGPKYVKQNTLK host organism:Mus musculus

    Publication: 6085322;

  57. Antibody reactivity to the immunodominant epitopes of the caprine arthritis-encephalitis virus gp38 transmembrane protein associates with the developm...

    ID: 1583185

    Description: epitope description:DVLEATYAMVQHVAK antigen name:envelope polyprotein host organism:Capra hircus Saanen

    Publication: 7933096;

  58. Use of synthetic peptides in the production and characterization of antibodies directed against predetermined specificities in rat immunoglobulin E.

    ID: 1583186

    Description: epitope description:YVFLPPEEEEKDKR antigen name:Ig epsilon chain C region host organism:Oryctolagus cuniculus New Zealand White

    Publication: 3702875;

  59. Immunogenicity and evolutionary variability of epitopes within IgA1 protease from serogroup A Neisseria meningitidis.

    ID: 1583190

    Description: epitope description:TKRFKINAI antigen name:IgA-specific serine endopeptidase (UniProt:Q9K0B4) host organism:Mus musculus antibody name:AH207

    Publication: 7511773;

  60. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583246

    Description: epitope description:TSKQVDDLIAKGNGKITQDELSKVVDNYELLKH antigen name:UniProt:S5PK59 host organism:Mus musculus BALB/c antibody name:MM605

    Publication: 8828217;

  61. K88 fimbrial antigens: identification of antigenic determinants by the use of synthetic peptides.

    ID: 1583268

    Description: epitope description:YREDMEY antigen name:UniProt:F4MCE8 host organism:Oryctolagus cuniculus albino

    Publication: 2467165;

  62. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583318

    Description: epitope description:FNDAFNGGDG antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  63. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583321

    Description: epitope description:AFNGGDGVDT antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  64. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583326

    Description: epitope description:GVDTIYGNDG antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  65. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583329

    Description: epitope description:TIYGNDGNDR antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  66. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583333

    Description: epitope description:GNDGNDRLFG antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  67. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583349

    Description: epitope description:ILDGGNGDDF antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  68. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583352

    Description: epitope description:GGNGDDFIDG antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  69. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583359

    Description: epitope description:GGKGNDLLHG antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  70. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583363

    Description: epitope description:GNDLLHGGKG antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  71. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583364

    Description: epitope description:GNDLLHGGKG antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  72. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583372

    Description: epitope description:GDDIFVHRKG antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  73. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583374

    Description: epitope description:IFVHRKGDGN antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  74. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583375

    Description: epitope description:IFVHRKGDGN antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  75. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583378

    Description: epitope description:HRKGDGNDII antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  76. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583381

    Description: epitope description:GDGNDIITDS antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  77. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583383

    Description: epitope description:NDIITDSDGN antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  78. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583385

    Description: epitope description:NDIITDSDGN antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  79. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583386

    Description: epitope description:ITDSDGNDKL antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  80. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583392

    Description: epitope description:NDKLSFSDSN antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  81. Peptide mimotopes of Mycobacterium tuberculosis carbohydrate immunodeterminants.

    ID: 5724

    Description: epitope description:QEPLMGTVPIRA host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15560754;

  82. Three-dimensional structures of idiotypically related Fabs with intermediate and high affinity for fluorescein.

    ID: 5736

    Description: epitope description:fluorescein host organism:Mus musculus BALB/c antibody name:anti-fluorescein 9-40

    Publication: 15178254;

  83. Antibody mapping of the linear epitopes of CMY-2 and SHV-1 beta-lactamases.

    ID: 5753

    Description: epitope description:GRVGMIEMDLASG antigen name:UniProt:W5Z3R5 host organism:Oryctolagus cuniculus

    Publication: 15388462;

  84. Antibody mapping of the linear epitopes of CMY-2 and SHV-1 beta-lactamases.

    ID: 5758

    Description: epitope description:NEALPGDARDTTT antigen name:UniProt:W5Z3R5 host organism:Oryctolagus cuniculus

    Publication: 15388462;

  85. Use of long synthetic peptides to study the antigenicity and immunogenicity of the Plasmodium vivax circumsporozoite protein.

    ID: 5786

    Description: epitope description:GDRADGQPA antigen name:Circumsporozoite protein, putative host organism:Homo sapiens antibody name:anti-P. vivax Ab

    Publication: 15582530;

  86. Use of long synthetic peptides to study the antigenicity and immunogenicity of the Plasmodium vivax circumsporozoite protein.

    ID: 5787

    Description: epitope description:GDRADGQPA antigen name:Circumsporozoite protein, putative host organism:Aotus griseimembra antibody name:anti-peptide Ab

    Publication: 15582530;

  87. Antibody mapping of the linear epitopes of CMY-2 and SHV-1 beta-lactamases.

    ID: 5806

    Description: epitope description:LNWPLKADSIING antigen name:UniProt:W5ZC56 host organism:Oryctolagus cuniculus

    Publication: 15388462;

  88. Antibody mapping of the linear epitopes of CMY-2 and SHV-1 beta-lactamases.

    ID: 5807

    Description: epitope description:SKVALAALPA antigen name:UniProt:W5ZC56 host organism:Oryctolagus cuniculus

    Publication: 15388462;

  89. Antibody mapping of the linear epitopes of CMY-2 and SHV-1 beta-lactamases.

    ID: 5809

    Description: epitope description:SYPNPVRVEAAWRILE antigen name:UniProt:W5ZC56 host organism:Oryctolagus cuniculus

    Publication: 15388462;

  90. Characterization of immunodominant linear B-cell epitopes on the carboxy terminus of the rinderpest virus nucleocapsid protein.

    ID: 6356

    Description: epitope description:SKKSAEALLKLQAMA antigen name:Nucleoprotein host organism:Cavia porcellus antibody name:anti-N125

    Publication: 15242937;

  91. Characterization of immunodominant linear B-cell epitopes on the carboxy terminus of the rinderpest virus nucleocapsid protein.

    ID: 6358

    Description: epitope description:MASILEGSTLGNDSLRTYN antigen name:Nucleoprotein host organism:Cavia porcellus antibody name:anti-N125

    Publication: 15242937;

  92. A Vibrio cholerae classical TcpA amino acid sequence induces protective antibody that binds an area hypothesized to be important for toxin-coregulated...

    ID: 6393

    Description: epitope description:GDFENSAAAAETG antigen name:UniProt:A5F392 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15385509;

  93. A Vibrio cholerae classical TcpA amino acid sequence induces protective antibody that binds an area hypothesized to be important for toxin-coregulated...

    ID: 6396

    Description: epitope description:AAAETGVGVIKSIAP antigen name:UniProt:A5F392 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15385509;

  94. A Vibrio cholerae classical TcpA amino acid sequence induces protective antibody that binds an area hypothesized to be important for toxin-coregulated...

    ID: 6403

    Description: epitope description:VGVIKSIAPASKNL antigen name:UniProt:A5F392 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15385509;

  95. A Vibrio cholerae classical TcpA amino acid sequence induces protective antibody that binds an area hypothesized to be important for toxin-coregulated...

    ID: 6409

    Description: epitope description:DLTNITHVEKLC antigen name:UniProt:A5F392 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15385509;

  96. A Vibrio cholerae classical TcpA amino acid sequence induces protective antibody that binds an area hypothesized to be important for toxin-coregulated...

    ID: 6411

    Description: epitope description:DLTNITHVEKLC antigen name:UniProt:A5F392 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15385509;

  97. A Vibrio cholerae classical TcpA amino acid sequence induces protective antibody that binds an area hypothesized to be important for toxin-coregulated...

    ID: 6413

    Description: epitope description:KLCKGTAPFGVAFGNS antigen name:UniProt:A5F392 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15385509;

  98. A Vibrio cholerae classical TcpA amino acid sequence induces protective antibody that binds an area hypothesized to be important for toxin-coregulated...

    ID: 6415

    Description: epitope description:KLCKGTAPFGVAFGNS antigen name:UniProt:A5F392 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15385509;

  99. Epitope mapping of Burkholderia pseudomallei serine metalloprotease: identification of serine protease epitope mimics.

    ID: 6428

    Description: epitope description:LTANTKSMALSG host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-serine protease Ab

    Publication: 15607634;

  100. Epitope mapping of Burkholderia pseudomallei serine metalloprotease: identification of serine protease epitope mimics.

    ID: 6432

    Description: epitope description:LTTHTKSMALSG host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-serine protease Ab

    Publication: 15607634;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston