Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "
  1. A large-scale evaluation of peptide vaccines against foot-and-mouth disease: lack of solid protection in cattle and isolation of escape mutants.

    ID: 1481449

    Description: epitope description:RHKQPLIAPAKQLLPPSAGARRGDLAHLAAAHARHLP host organism:Bos taurus Friesian

    Publication: 9060612;
  2. Failure to detect evidence of human T-lymphotropic virus (HTLV) type I and type II in blood donors with isolated gag antibodies to HTLV-I/II.

    ID: 1481646

    Description: epitope description:KKPNRQGLGYYSPSYNDP antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1627806;
  3. Enhanced specificity of truncated transmembrane protein for serologic confirmation of human T-cell lymphotropic virus type 1 (HTLV-1) and HTLV-2 infec...

    ID: 1481735

    Description: epitope description:IVKNHKNLLKIAQYAAQNRRGLDLLFWEQGGLCKALQEQCRFPN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8586709;
  4. Mapping of three antigenic sites on the haemagglutinin-neuraminidase protein of Newcastle disease virus.

    ID: 1481748

    Description: epitope description:D287, T290, E293 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus antibody name:445

    Publication: 2464879;
  5. Mapping of three antigenic sites on the haemagglutinin-neuraminidase protein of Newcastle disease virus.

    ID: 1481751

    Description: epitope description:E347, D349 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus antibody name:NHN-8 and NHN-10

    Publication: 2464879;
  6. Mapping of three antigenic sites on the haemagglutinin-neuraminidase protein of Newcastle disease virus.

    ID: 1481755

    Description: epitope description:K284 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus antibody name:8C11

    Publication: 2464879;
  7. Mapping of three antigenic sites on the haemagglutinin-neuraminidase protein of Newcastle disease virus.

    ID: 1481757

    Description: epitope description:N481 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus antibody name:NHN-1

    Publication: 2464879;
  8. Mapping of three antigenic sites on the haemagglutinin-neuraminidase protein of Newcastle disease virus.

    ID: 1481763

    Description: epitope description:R460 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus antibody name:NHN-3

    Publication: 2464879;
  9. Mapping of three antigenic sites on the haemagglutinin-neuraminidase protein of Newcastle disease virus.

    ID: 1481765

    Description: epitope description:K284 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus antibody name:8C11

    Publication: 2464879;
  10. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481778

    Description: epitope description:CVCRSCRTMSLQKTVEKLFD antigen name:Immunogenic protein host organism:Homo sapiens

    Publication: 17403055;
  11. Synergistic effect of immunization with a peptide cocktail inducing antibody, helper and cytotoxic T-cell responses on protection against respiratory ...

    ID: 1481784

    Description: epitope description:HWSISKPQ host organism:Mus musculus BALB/c

    Publication: 10374957;
  12. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481807

    Description: epitope description:SISSLSNKIVNYESKIEELEKELKEVK antigen name:Uncharacterized protein PFB0145c host organism:Homo sapiens antibody name:Human sera

    Publication: 17653272;
  13. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481809

    Description: epitope description:DNNVNNMDNNVNNVDNNVNNVDNNLNNVDNNVNN antigen name:AP2/ERF domain-containing protein PFD0985w host organism:Homo sapiens antibody nam...

    Publication: 17653272;
  14. Immunogenicity of variable regions of the surface envelope glycoprotein of HTLV type I and identification of new major epitopes in the 239-261 region.

    ID: 1481815

    Description: epitope description:PHWTKKPNRNGGGYYSASYSDP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8798979;
  15. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481818

    Description: epitope description:IKTMNTQISTLKNDVHLLNEQIDKLNNEKGTLNSKISELNVQIMDL antigen name:Uncharacterized protein PFB0145c host organism:Mus musculus antibody n...

    Publication: 17653272;
  16. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481823

    Description: epitope description:KKRNVEEELHSLRKNYNIINEEIEEIT antigen name:RING finger protein PFF0165c host organism:Mus musculus antibody name:Mouse sera

    Publication: 17653272;
  17. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481825

    Description: epitope description:KIQIEEIKKETNQINKDIDHIEMNIINLKKKIEF antigen name:Serine--tRNA ligase, cytoplasmic host organism:Mus musculus antibody name:Mouse se...

    Publication: 17653272;
  18. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481836

    Description: epitope description:CVCRSCRTMSLQKTVEKLFDELDKDKSGKISCAELKSALQSCSAEPLDDDH antigen name:Immunogenic protein host organism:Mus musculus Outbred

    Publication: 17403055;
  19. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481837

    Description: epitope description:ELKSALQSCSAEPLDDDHVKAFLDKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Mus musculus Outbred

    Publication: 17403055;
  20. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481838

    Description: epitope description:ELDKDKSGKISCAELKSALQ antigen name:Immunogenic protein host organism:Mus musculus Outbred

    Publication: 17403055;
  21. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481845

    Description: epitope description:AELKSALQSCSAEPLDDDHVKAFLDK antigen name:Immunogenic protein host organism:Homo sapiens

    Publication: 17403055;
  22. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481846

    Description: epitope description:HVKAFLDKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Homo sapiens

    Publication: 17403055;
  23. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481860

    Description: epitope description:ELKSALQSCSAEPLDDDHVKAFLDKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Homo sapiens

    Publication: 17403055;
  24. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481866

    Description: epitope description:CVCRSCRTMSLQKTVEKLFDELDKDKSGKISCAELKSALQ antigen name:Immunogenic protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17403055;
  25. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481875

    Description: epitope description:DKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Mus musculus BALB/c

    Publication: 17403055;
  26. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481876

    Description: epitope description:ELDKDKSGKISCAELKSALQSCSAEPLDDDH antigen name:Immunogenic protein host organism:Mus musculus BALB/c

    Publication: 17403055;
  27. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481879

    Description: epitope description:ELKSALQSCSAEPLDDDHVKAFLDKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Mus musculus BALB/c

    Publication: 17403055;
  28. An epitope located at the C terminus of isolated VP1 of foot-and-mouth disease virus type O induces neutralizing activity but poor protection.

    ID: 1481882

    Description: epitope description:GDLQVLA antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:anti-146-152

    Publication: 2418152;
  29. An epitope located at the C terminus of isolated VP1 of foot-and-mouth disease virus type O induces neutralizing activity but poor protection.

    ID: 1481908

    Description: epitope description:RHKQKIVAPVK antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:MCA a-A

    Publication: 2418152;
  30. Immunogenicity of variable regions of the surface envelope glycoprotein of HTLV type I and identification of new major epitopes in the 239-261 region.

    ID: 1481930

    Description: epitope description:VLYSPNVSVPSSSSTPLLYPSLA antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8798979;
  31. A chimaeric plant virus vaccine protects mice against a bacterial infection.

    ID: 1481958

    Description: epitope description:NEYGVEGGRVNAVGSGDNATAEGRAINRRVEAEV host organism:Mus musculus ICR

    Publication: 10463172;
  32. Characterization of monoclonal antibodies raised against recombinant respiratory syncytial virus nucleocapsid (N) protein: identification of a region ...

    ID: 1481969

    Description: epitope description:LYDAAKAYAEQLKENGVINY antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:alphaN002, alphaN003 and alphaN014

    Publication: 11689048;
  33. Epitope mapping of foot-and-mouth disease virus with neutralizing monoclonal antibodies.

    ID: 1481980

    Description: epitope description:SKYSAGGTGRRGDLGPLAARVAAQLP antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-Peptide 135-16...

    Publication: 2471783;
  34. Antigenicity and immunogenicity of synthetic peptides of foot-and-mouth disease virus.

    ID: 1482000

    Description: epitope description:LVRMKRA antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:18

    Publication: 2434606;
  35. Antigenicity and immunogenicity of synthetic peptides of foot-and-mouth disease virus.

    ID: 1482003

    Description: epitope description:LVRMKRA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2434606;
  36. Antigenicity and immunogenicity of synthetic peptides of foot-and-mouth disease virus.

    ID: 1482021

    Description: epitope description:YKQKIIAP antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:18

    Publication: 2434606;
  37. An in vitro selected binding protein (affibody) shows conformation-dependent recognition of the respiratory syncytial virus (RSV) G protein.

    ID: 1482044

    Description: epitope description:TKKPTFKTTKKDHKPQTTKPKEVPTTKP antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:8D3

    Publication: 10231093;
  38. Chimeric foot-and-mouth disease viruses: evaluation of their efficacy as potential marker vaccines in cattle.

    ID: 1482048

    Description: epitope description:KYSASGSGVRGDFGSLAPRVAR antigen name:Genome polyprotein host organism:Bos taurus Holstein-Friesian

    Publication: 18342409;
  39. A peptide construct containing B-cell and T-cell epitopes from the foot-and-mouth disease viral VP1 protein induces efficient antiviral protection.

    ID: 1482053

    Description: epitope description:KYSAGGMGRRGDLEPLAARVAAQL antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

    Publication: 10075164;
  40. Analysis of neutralizing epitopes on foot-and-mouth disease virus.

    ID: 1482055

    Description: epitope description:LRGDLQVLAQKVARTL antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:anti-peptide A

    Publication: 2835507;
  41. Analysis of neutralizing epitopes on foot-and-mouth disease virus.

    ID: 1482056

    Description: epitope description:LRGDLQVLAQKVARTL antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:anti-peptide A

    Publication: 2835507;
  42. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475076

    Description: epitope description:IANTTSFNGKQLLSGNFINQEFQIGASSNQ antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  43. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475077

    Description: epitope description:IANTTSFNGKQLLSGNFINQEFQIGASSNQ antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  44. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475089

    Description: epitope description:ASSNQTVKATIGATQSSKIGLTRFETGGRI antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  45. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475097

    Description: epitope description:TGGRISSSGEVQFTLKNYNGIDDFQFQKVV antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  46. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475113

    Description: epitope description:FQKVVISTSVGTGLGALADEINKNADKTGV antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  47. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475115

    Description: epitope description:FQKVVISTSVGTGLGALADEINKNADKTGV antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  48. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475126

    Description: epitope description:DDFAINGVKIGKVDYKDGDANGALVAAINS antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  49. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475128

    Description: epitope description:DDFAINGVKIGKVDYKDGDANGALVAAINS antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  50. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475129

    Description: epitope description:DDFAINGVKIGKVDYKDGDANGALVAAINS antigen name:Flagellin A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17704944;

Displaying 50 of 1,510,353 results for " "