Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475193

    Description: epitope description:MSSAGSGFSSGSGYSVGSGKNYSTGFANAI antigen name:Flagellin A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17704944;

  2. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475199

    Description: epitope description:FANAIAISAASQLSTVYNVSAGSGFSSGST antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  3. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475203

    Description: epitope description:FANAIAISAASQLSTVYNVSAGSGFSSGST antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  4. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475204

    Description: epitope description:FANAIAISAASQLSTVYNVSAGSGFSSGST antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  5. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475208

    Description: epitope description:SSGSTLSQFATMKTTAFGVKDETAGVTTLK antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston